UniProt UniProt http://www.uniprot.org sunayama-2004-1 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Human placental cDNA library Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-4 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-2 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-3 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-5 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-6 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation sunayama-2004-7 Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Cell Death Differ. (1350-9047) 2004 mimix curation c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK c1qbp_chlae Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP Globular head receptor of C1 complement protein Mitochondrial matrix protein p32 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MLPLLRCVPRVLGSAVPSLRAAAPASPFRQLLTPGPRLCARPFGLLSVRAGSERRPGLLRPRGPCACGCGCGLLHTEGDKAFVDFLNDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLMRKVAGEKITVTFNINNSIPPTFDGEEEPTQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSSGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKSFVKSQ hrk-c1qbp 1323379 n/a 1323386 unspecified role unspecified role prey prey n/a 1323387 unspecified role unspecified role bait bait physical association physical association false false false no figure hrk-c1qbp-7 1323379 n/a 1323387 unspecified role unspecified role bait bait n/a 1323388 unspecified role unspecified role prey prey physical association physical association false false false no figure hrk-bcl2l1 1323379 n/a 1323389 unspecified role unspecified role prey prey n/a 1323387 unspecified role unspecified role bait bait physical association physical association false false false no figure c1qbp-hrk 1323380 n/a 1323387 unspecified role unspecified role prey prey n/a 1323386 unspecified role unspecified role bait bait physical association physical association false false false 2b and 3c hrk-c1qbp-6 1323380 n/a 1323386 unspecified role unspecified role prey prey n/a 1323387 unspecified role unspecified role bait bait physical association physical association false false false 4b bcl2l1-c1qbp 1323380 n/a 1323387 unspecified role unspecified role prey prey n/a 1323390 unspecified role unspecified role bait bait physical association physical association false false false 2b, 3c hrk-c1qbp-1 1323381 n/a 1323386 unspecified role unspecified role prey prey n/a 1323387 unspecified role unspecified role bait bait physical association physical association false false false 1 hrk-c1qbp-2 1323382 n/a 1323387 unspecified role unspecified role bait bait n/a 1323386 unspecified role unspecified role prey prey physical association physical association false false false 2a hrk-c1qbp-3 1323383 n/a 1323387 unspecified role unspecified role bait bait n/a 1323386 unspecified role unspecified role prey prey physical association physical association false false false 2c hrk-c1qbp-5 1323384 n/a 1323391 unspecified role unspecified role prey prey n/a 1323387 unspecified role unspecified role bait bait physical association physical association false false false 2d c1qbp-hrk-1 1323385 n/a 1323387 unspecified role unspecified role neutral component neutral component n/a 1323386 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5c