IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cande-2004-1 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation cande-2004-2 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation cande-2004-3 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation cande-2004-4 AIF and cyclophilin A cooperate in apoptosis-associated chromatinolysis. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cande C., Vahsen N., Kouranti I., Schmitt E., Daugas E., Spahr C., Luban J., Kroemer R.T., Giordanetto F., Garrido C., Penninger J.M., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis The co-inmunoprecipitation experiments depicted in figures 2c and 2d are not included because the origin of AIF constructs is not explicit in the paper. kroemer@igr.fr; kroemer@orange.fr Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ppia_rat Peptidyl-prolyl cis-trans isomerase A Ppia Cyclophilin A Cyclosporin A-binding protein Rotamase A p1B15 p31 protein protein rat Rattus norvegicus (Rat) Rat MVNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL aifm1_mouse Apoptosis-inducing factor 1, mitochondrial Programmed cell death protein 8 Aifm1 Aif Pdcd8 protein protein mouse Mus musculus Mouse MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED aifm1_human Apoptosis-inducing factor 1, mitochondrial AIFM1 AIF PDCD8 Programmed cell death protein 8 protein protein human Homo sapiens Human MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED ppia_human Peptidyl-prolyl cis-trans isomerase A Cyclophilin A Cyclosporin A-binding protein PPIA CYPA Rotamase A protein protein human Homo sapiens Human MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE aifm1-ppia 1214566 n/a 1214570 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] n/a 1214571 unspecified role unspecified role bait bait purified purified trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false text aifm1-ppia-5 1214567 n/a 1214572 unspecified role unspecified role neutral component neutral component n/a 1214573 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1 This interaction only happens under apoptotic conditions and it is independent of caspase activity as assesed by caspase inhibitor Z-VAD.fmk treatment. aifm1-ppia-2 1214568 n/a 1214573 unspecified role unspecified role prey prey n/a 1214572 unspecified role unspecified role bait bait physical association physical association false false false 2a Apoptosis-inducing conditions such as STS treatment or serum deprivation are required for the interaction to happen. aifm1-ppia-4 1214569 n/a 1214573 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1214571 unspecified role unspecified role bait bait purified purified trx tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2b