IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ whitfield-2003-1 High-throughput methods to detect dimerization of Bcl-2 family proteins. in vitro In vitro spa scintillation proximity assay SPA RIA Radio Immuno Assay spa predetermined predetermined participant predetermined Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 Anal. Biochem. (0003-2697) 2003 whitfield-2003-2 High-throughput methods to detect dimerization of Bcl-2 family proteins. in vitro In vitro htrf homogeneous time resolved fluorescence homogeneous time-resolved fluorescence htrf predetermined predetermined participant predetermined Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 Anal. Biochem. (0003-2697) 2003 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL bclxl-bak-1 Interaction of Bcl-XL with BAK identified by scintillation proximity assay 220079 N/A 220081 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 220082 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro 220090 220088 physical association physical association false false false By HRK or BIM, which bind to BCL-XL incompetition to HRK bclxl-bim-1 Interaction of Bcl-XL with BIM identified by scintillation proximity assay 220079 N/A 220083 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 220081 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 220098 220094 physical association physical association false false false bclxl-hrk-1 Interaction of Bcl-XL with HRK identified by scintillation proximity assay 220079 N/A 220084 unspecified role unspecified role prey prey n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 220081 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 220105 220102 physical association physical association false false false By BAK or BIM, which bind to BCL-XL incompetition to HRK bclxl-bak-2 Interaction of Bcl-XL with BAK identified by homogeneous time-resolved fluorescence resonance energy transfer 220080 N/A 220081 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 220082 unspecified role unspecified role fluorescence donor fluorescence donor region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro physical association physical association false false false bclxl-bim-2 Interaction of Bcl-XL with BIM identified by homogeneous time-resolved fluorescence resonance energy transfer assay 220080 N/A 220083 unspecified role unspecified role fluorescence donor fluorescence donor n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 220081 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false