IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chung-2003-2 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation chung-2003-3 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation chung-2003-6 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation chung-2003-4 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation chung-2003-1 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation chung-2003-5 CR6-interacting factor 1 interacts with Gadd45 family proteins and modulates the cell cycle. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chung HK., Yi YW., Jung NC., Kim D., Suh JM., Kim H., Park KC., Song JH., Kim DW., Hwang ES., Yoon SH., Bae YS., Kim JM., Bae I., Shong M. Apoptosis - Interactions involving proteins with a function related to apoptosis insoobae@hotmail.com, minhos@cnu.ac.kr Matchmaker two-hybrid cDNA library from K-562 cells J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation ga45g_human Growth arrest and DNA damage-inducible protein GADD45 gamma DDIT2 Cytokine-responsive protein CR6 DNA damage-inducible transcript 2 protein GADD45G CR6 protein protein human Homo sapiens Human MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE g45ip_human Growth arrest and DNA damage-inducible proteins-interacting protein 1 39S ribosomal protein L59, mitochondrial MRPL59 CR6-interacting factor 1 CKII beta-associating protein Papillomavirus L2-interacting nuclear protein 1 p53-responsive gene 6 protein Mitochondrial large ribosomal subunit protein mL64 GADD45GIP1 PLINP1 PRG6 protein protein human Homo sapiens Human MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS ga45a_human Growth arrest and DNA damage-inducible protein GADD45 alpha DNA damage-inducible transcript 1 protein GADD45A DDIT1 GADD45 protein protein human Homo sapiens Human MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER ga45b_mouse Growth arrest and DNA damage-inducible protein GADD45 beta Gadd45b Myd118 Myeloid differentiation primary response protein MyD118 Negative growth regulatory protein MyD118 protein protein mouse Mus musculus Mouse MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER g45ip_chlae Growth arrest and DNA damage-inducible proteins-interacting protein 1 GADD45GIP1 PLINP Papillomavirus L2-interacting nuclear protein 1 39S ribosomal protein L59, mitochondrial MRPL59 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MAASVRKARSLLGLTATLAPGSRGYRAPPPPRREPGPWWPDPEDLLTHRWQLGPRYAAKQFARYGAASGVAPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKHLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRERWEKAQADKERRARLQAEAQELLGYQVNPKSARFQELLQDLEKKERKRLKEEKQRQKQEARAAALAAAAAQDPAASGAPSS gadd45g-gadd45gip1-2 Interaction between GADD45G and GADD45GAP1 identified by pulldown 799702 n/a 799708 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799709 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 3A gadd45a-gadd45gip1-1 Interaction between GADD45A and GADD45GAP1 identified by pulldown 799702 n/a 799709 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 799710 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 3A gadd45b-gadd45gip1-1 Interaction between GADD45B and GADD45GAP1 identified by pulldown 799702 n/a 799711 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799709 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 3A gadd45a-gadd45gip1-2 Interaction between GADD45A and GADD45GAP1 identified by mammalian 2H 799703 n/a 799710 unspecified role unspecified role bait bait n/a 799709 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig. 3B gadd45b-gadd45gip1-2 Interaction between GADD45B and GADD45GAP1 identified by mammalian 2H 799703 n/a 799711 unspecified role unspecified role bait bait n/a 799709 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig. 3B gadd45g-gadd45gip1-3 Interaction between GADD45G and GADD45GAP1 identified by mammalian 2H 799703 n/a 799709 unspecified role unspecified role prey prey in vitro In vitro n/a 799708 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3B gadd45g-gadd45gip1-5 Interaction between GADD45G and GADD45GAP1 identified by coimmunoprecipitation 799704 n/a 799712 unspecified role unspecified role prey prey n/a 799708 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3F gadd45a-gadd45gip1-4 Interaction between GADD45A and GADD45GAP1 identified by coimmunoprecipitation 799704 n/a 799710 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799712 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3F gadd45b-gadd45gip1-4 Interaction between GADD45B and GADD45GAP1 identified by coimmunoprecipitation 799704 n/a 799711 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799712 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3F gadd45b-gadd45gip1-3 Interaction between GADD45B and GADD45GAP1 identified by coimmunoprecipitation 799705 n/a 799709 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799711 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3D gadd45a-gadd45gip1-3 Interaction between GADD45A and GADD45GAP1 identified by coimmunoprecipitation 799705 n/a 799710 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799709 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3C gadd45g-gadd45gip1-1 Interaction between GADD45G and GADD45GAP1 identified by y2H 799706 n/a 799708 unspecified role unspecified role bait bait n/a 799709 unspecified role unspecified role prey prey physical association physical association false false false gadd45g-gadd45gip1-4 Interaction between GADD45G and GADD45GAP1 identified by coimmunoprecipitation 799707 n/a 799708 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 799709 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3E It is not clear if the GADD45G immunoprecipitated in this experiment is endogenous or transfected human. It has been assumed that this is exogenous.