IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ reddy-2003-1 Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. crigr-cho-c1 GRP78 overexpressing, DHFR-deficient CHO cells cho-c1 GRP78-expressing, DHFR-deficient CHO cells (C-.1) confocal microscopy confocal microscopy immunostaining immunostaining Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation reddy-2003-2 Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. crigr-cho-c1 GRP78 overexpressing, DHFR-deficient CHO cells cho-c1 GRP78-expressing, DHFR-deficient CHO cells (C-.1) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation reddy-2003-3 Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation bip_crigr Endoplasmic reticulum chaperone BiP HSPA5 78 kDa glucose-regulated protein Binding-immunoglobulin protein GRP78 Heat shock protein 70 family protein 5 Heat shock protein family A member 5 Immunoglobulin heavy chain-binding protein I79_019946 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKFPMVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTSEKDEL g3il63_crigr I79_024625 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MADDQNCVAELEKVDPSSEDGVDAKPDRSSIISSILWKKKKNAPPCPVKTTRDRVPTHLYRMDFEKMGKCIIINNKNFDKVTGMDVRNGTDKDAEALFKCFRSLGFDVVVYNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGVQADSGPISETDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILDEHGKDLEIMQILTRVNDRVARHFESQCDDPCFNEKKQIPCMVSMLTKELYFGR g3i8r9-g3il63 1343565 n/a 1343568 unspecified role unspecified role neutral component neutral component n/a 1343569 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1c g3il63-g3i8r9 1343566 n/a 1343568 unspecified role unspecified role prey prey fragment of atp-binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1343569 unspecified role unspecified role bait bait physical association physical association false false false 6a and 6b g3il63-g3i8r9-1 1343567 n/a 1343569 unspecified role unspecified role bait bait n/a 1343568 unspecified role unspecified role prey prey physical association physical association false false false 6a and 6b