IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ park-2003-1 Inhibition of ubiquitin ligase Siah-1A by disabled-1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Biochem. Biophys. Res. Commun. (0006-291X) 2003 park-2003-2 Inhibition of ubiquitin ligase Siah-1A by disabled-1. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Biochem. Biophys. Res. Commun. (0006-291X) 2003 park-2003-3 Inhibition of ubiquitin ligase Siah-1A by disabled-1. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Biochem. Biophys. Res. Commun. (0006-291X) 2003 dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS sia1a_mouse E3 ubiquitin-protein ligase SIAH1A Seven in absentia homolog 1a RING-type E3 ubiquitin transferase SIAH1A Siah1a protein protein mouse Mus musculus Mouse MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC dab1-siah1a-1 Dab1 interacts with Siah detected by Y2H. 145684 N/A 145687 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 145688 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false dab1-siah1a-2 Dab1 interacts with siah, as detected by coimmunoprecipitation. 145685 N/A 145688 unspecified role unspecified role prey prey N/A 145687 unspecified role unspecified role bait bait physical association physical association false false false Dab1 was EGFP-tagged, and Siah1A was flag epitope-tagged. Cell lysate was immunoprecipitataed with anti-Dab1 or anti-Siah. The interaction appeared to be independent of phosphorylation of Dab1. dab1-siah1a-3 Dab1 interacts with Siah, as detected by GST pull down. 145686 N/A 145687 unspecified role unspecified role prey prey N/A 145688 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false P61092 was GST-tagged.