UniProt UniProt http://www.uniprot.org xue-2002-1 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 xue-2002-6 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. human-hut78 Homo sapiens HUT-78 T cell lymphoma hut78 HUT-78 human T cell lymphoma anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 xue-2002-2 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 xue-2002-3 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pull down pull down anti tag western anti tag western blot anti tag western Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 xue-2002-4 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 xue-2002-5 Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. mouse-thymus Mus musculus thymus thymus anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Xue L., Chu F., Cheng Y., Sun X., Borthakur A., Ramarao M., Pandey P., Wu M., Schlossman SF., Prasad KV. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of BCL-XL assumed from previous work of contributer. Kanteti@uic.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK o15304-1 Apoptosis regulatory protein Siva Siva-1 SIVA1 SIVA CD27-binding protein protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET siva_human Apoptosis regulatory protein Siva CD27-binding protein SIVA1 SIVA protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET siva_mouse Apoptosis regulatory protein Siva Siva1 Siva CD27-binding protein protein protein mouse Mus musculus Mouse MPKRSCPFADAAPLQLKVHVGLKELSHGVFAERYSREVFERTKQLLFQGARAYRDHISSEDCSVNHLQESLKSGVVGAPQPARGQMLIGPDGRLTRCQAQASEGGLPRTAPIACSSCMRSVDGKAVCSQCERALCGQCVYTCWGCGALACVLCGLADYADDGEKTLCTSCAMFEA q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK siva1-bcl2l1-3 665327 N/A 665333 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 665334 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A Interaction was dose-dependent on BCL2L1. siva1-bcl2l1-5 665327 N/A 665334 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 665333 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 2B siva1-bcl2l1-8 665328 N/A 665333 unspecified role unspecified role prey prey N/A 665335 unspecified role unspecified role bait bait physical association physical association false false false 3C siva1-bcl2l1-9 665328 N/A 665335 unspecified role unspecified role prey prey N/A 665333 unspecified role unspecified role bait bait physical association physical association false false false 3C siva1-bcl2l1-10 665329 N/A 665333 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 665334 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 2B siva1-bcl2l1-6 665330 N/A 665333 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 665334 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2C and 4A siva1-bcl2l1-7 665331 N/A 665333 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 665334 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 3A bcl2l1-siva1-3 665332 N/A 665336 unspecified role unspecified role prey prey N/A 665337 unspecified role unspecified role bait bait physical association physical association false false false 3B Amount of Siva bound to Bcl-XL increased on CD3 cross-linking