MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint eyckerman-2001-1 Design and application of a cytokine-receptor-based interaction trap. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Eyckerman S., Verhee A., der Heyden JV., Lemmens I., Ostade XV., Vandekerckhove J., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a region of the bait protein is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2b, 2c, 5 jan.tavernier@ugent.be Nat. Cell Biol. (1465-7392) 2001 eyckerman-2001-3 Design and application of a cytokine-receptor-based interaction trap. human-tf1 Human erythroleukaemia TF1 cells tf1 Human erythroleukaemia TF1 cells mappit mammalian protein protein interaction trap mappit nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eyckerman S., Verhee A., der Heyden JV., Lemmens I., Ostade XV., Vandekerckhove J., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a region of the bait protein is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2b, 2c, 5 jan.tavernier@ugent.be Bait library - retroviral TF1 cDNA library (2 � 10 EXP6 independent clones). Nat. Cell Biol. (1465-7392) 2001 eyckerman-2001-2 Design and application of a cytokine-receptor-based interaction trap. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eyckerman S., Verhee A., der Heyden JV., Lemmens I., Ostade XV., Vandekerckhove J., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a region of the bait protein is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2b, 2c, 5 jan.tavernier@ugent.be Bait library - retroviral HEK293 cDNA library (2 � 10 EXP6 independent clones). Nat. Cell Biol. (1465-7392) 2001 p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD lt_sv40 Large T antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET cish_mouse Cytokine-inducible SH2-containing protein CIS-1 Suppressor of cytokine signaling Cish Cis protein protein mouse Mus musculus Mouse MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL epor_human Erythropoietin receptor EPOR protein protein human Homo sapiens Human MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS socs2_human Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 STAT-induced STAT inhibitor 2 CIS2 SSI2 STATI2 SOCS2 protein protein human Homo sapiens Human MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV cish_human Cytokine-inducible SH2-containing protein CIS-1 Suppressor of cytokine signaling Protein G18 CISH G18 protein protein human Homo sapiens Human MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAPTPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL sv40-tp53-1 Interactions between SV40 large T antigen and murine p53 demonstrated by MAPPIT 195728 N/A 195731 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 195732 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 195741 195739 physical association physical association false false false epor-cish-4 Interaction between human EpoR and Murine CIS-1 demonstrated by MAPPIT 195728 N/A 195733 unspecified role unspecified role prey prey N/A 195734 unspecified role unspecified role bait bait P19235:p.Tyr426Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false epor-socs2-3 Interaction between human EpoR and SOCS2 demonstrated by MAPPIT 195728 N/A 195734 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P19235:p.Tyr426Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 195735 unspecified role unspecified role prey prey physical association physical association false false false SOCS2 described as fragment but no detail given Erythropoietin Phosphorylation of SOCS2 - dependent on treatment of cells with erythropoietin epor-socs2-5 Interaction between human EpoR and SOCS2 demonstrated by MAPPIT 195729 N/A 195735 unspecified role unspecified role prey prey N/A 195734 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Erythropoietin epor-cish-6 Interaction between human EpoR and CISH demonstrated by MAPPIT 195729 N/A 195736 unspecified role unspecified role prey prey N/A 195734 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Erythropoietin epor-socs2-4 Interaction between human EpoR and SOCS2 demonstrated by MAPPIT 195730 N/A 195735 unspecified role unspecified role prey prey N/A 195734 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false SOCS2 described as fragment but no detail given Erythropoietin