IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ verhagen-2002-4 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation verhagen-2002-5 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation verhagen-2002-1 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation verhagen-2002-2 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation verhagen-2002-3 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation verhagen-2002-6 HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation htra2_mouse Serine protease HTRA2, mitochondrial Htra2 Omi Prss25 High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 protein protein mouse Mus musculus Mouse MAALKAGRGANWSLRAWRALGGIFWRKPPLLAPDLRALLTSGTPDSQIWMTYGTPSLPAQVPEGFLASRADLTSRTPDLWARLNVGTSGSSDQEARRSPGSRRREWLAVAVGAGGAVVLLLWGWGRGLSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE xiap_mouse E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP homolog A Xiap Aipa Api3 Miha Birc4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein mouse Mus musculus Mouse MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS q65368_npvos Opiap2 protein protein npvos Orgyia pseudotsugata single capsid nuclear polyhedrosis virus MDLQRFNFLIMTTQGRVATMSFMSLDHAQKVDLAKTGLFFHNNLIKCIGCRATMDRVDARRVKRHTYSDTCVSAINALVANESLRKRSFASFKWARRQFGSRAREVDMLSRRGFYCVGKRLRCAGCKVVTTCVSVDGAQRAHAADCAFRRVFDVDLDACALANVVRVDLPPPRLE birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS diablo/htra2_chimera Chimera of N-terminal Diablo (1-53) and mature HtrA2 (134-458) protein protein mouse Mus musculus Mouse MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED htra2_human Serine protease HTRA2, mitochondrial High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 HTRA2 PRSS25 OMI protein protein human Homo sapiens Human MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE dbloh_mouse Diablo homolog, mitochondrial Diablo Smac Direct IAP-binding protein with low pI Second mitochondria-derived activator of caspase protein protein mouse Mus musculus Mouse MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED xiap-htra2-2 1214651 n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214658 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2a xiap-htra2-3 1214651 n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214659 unspecified role unspecified role bait bait P98170:p.[Asp148Ala;Asp214Ser;Trp310Ala;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P98170:p.Asp214Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P98170:p.[Asp148Ala;Asp214Ser;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bir2 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range false bir3 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range false P98170:p.[Asp148Ala;Asp214Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P98170:p.[Asp214Ser;Trp310Ala;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2a, 2b and 3 opiap2-htra2 1214651 n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214660 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2a birc2-htra2-1 1214651 n/a 1214661 unspecified role unspecified role unspecified role unspecified role sequence minus ring domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2a xiap-htra2-4 1214651 n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1214659 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false bir2 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range false physical association physical association false false false 2c xiap-htra2-5 1214651 n/a 1214657 unspecified role unspecified role prey prey Q9JIY5:p.Tyr147Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1214659 unspecified role unspecified role bait bait bir3 domain sufficient to bind sufficient binding region sufficient to bind range range range range false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2c xiap-htra2-6 1214651 n/a 1214657 unspecified role unspecified role prey prey Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214659 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2c xiap-htra2-7 1214652 n/a 1214657 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214658 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 6c xiap-diablo_htra2 1214652 n/a 1214662 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false diablo/htra2_chimera:p.Ser226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false diablo/htra2_chimera:p.Ala54Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false diablo/htra2_chimera:p.[Ala54Gly;Ser226Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1214658 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 6c xiap-diablo 1214653 n/a 1214663 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1214658 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1214664 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1a Even though the identity of the preys is not given in this experiment, it has been inferred from their identification in later experiments (Htra2) or in previous publications (DIABLO). xiap-htra2 1214654 n/a 1214663 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1214664 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1214659 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false 1b Even though the identity of the preys is not given in this experiment, it has been inferred from their identification in later experiments (Htra2) or in previous publications (DIABLO). xiap-htra2-1 1214655 n/a 1214659 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1214664 unspecified role unspecified role prey prey physical association physical association false false false 1c and 1d xiap-diablo-1 1214656 n/a 1214665 unspecified role unspecified role prey prey Q9JIQ3:p.Ala54Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1214658 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 6c