UniProt UniProt http://www.uniprot.org geddes-2001-1 Human CARD12 is a novel CED4/Apaf-1 family member that induces apoptosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Geddes B.J., Wang L., Huang W.J., Lavellee M., Manji G.A., Brown M., Jurman M., Cao J., Morgenstern J., Merriam S., Glucksmann M.A., DiStefano P.S., Bertin J. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of caspase-1 construct (gift of E. Alnemri) according pmid 7876192 (cloning by E.A., reference in UniProt). CARD domain range for PYCARD/ASC according to UniProt. Origin of PYCARD/ASC inferred from sequence length given in PMID: 11053425 bertin@mpi.com Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation geddes-2001-2 Human CARD12 is a novel CED4/Apaf-1 family member that induces apoptosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Geddes B.J., Wang L., Huang W.J., Lavellee M., Manji G.A., Brown M., Jurman M., Cao J., Morgenstern J., Merriam S., Glucksmann M.A., DiStefano P.S., Bertin J. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of caspase-1 construct (gift of E. Alnemri) according pmid 7876192 (cloning by E.A., reference in UniProt). CARD domain range for PYCARD/ASC according to UniProt. Origin of PYCARD/ASC inferred from sequence length given in PMID: 11053425 bertin@mpi.com Biochem. Biophys. Res. Commun. (0006-291X) 2001 Only protein-protein interactions imex curation nlrc4_human NLR family CARD domain-containing protein 4 NLRC4 CLAN CLAN1 UNQ6189/PRO20215 CARD12 IPAF Caspase recruitment domain-containing protein 12 Ice protease-activating factor CARD, LRR, and NACHT-containing protein protein protein human Homo sapiens Human MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILKKGSESCNLFLKSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQRIAMLWGSGKCKALTKFKFVFFLRLSRAQGGLFETLCDQLLDIPGTIRKQTFMAMLLKLRQRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTTTECLRHIRQFGALTAEVGDMTEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMGESEFHSHTQTTLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDVLLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSISDITSTYSSLLRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAEDTGGIHMEEAPETYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGVAGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIMDNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLLKHLEEVPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFKLVTA asc_human Apoptosis-associated speck-like protein containing a CARD PYD and CARD domain-containing protein Target of methylation-induced silencing 1 Caspase recruitment domain-containing protein 5 ASC CARD5 TMS1 PYCARD protein protein human Homo sapiens Human MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH nlrc4-nlrc4 1315157 n/a 1315159 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1315159 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1315166 1315164 physical association physical association false false false 4 nlrc4-asc-1 1315157 n/a 1315159 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1315160 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1315171 1315169 physical association physical association false false false 4 nlrc4-casp1 1315158 n/a 1315159 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1315161 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5 Also reverse CoIP detected but data not shown.