IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ goyal-2000-1 Induction of apoptosis by Drosophila reaper, hid and grim through inhibition of IAP function. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goyal L., McCall K., Agapite J., Hartwieg E., Steller H. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2000 diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS rpr_drome Cell death protein rpr Protein reaper rpr CG4319 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCHPKTGRKSGKYRKPSQ hid_drome Cell death protein hid hid Protein head involution defective Protein wrinkled W CG5123 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVPFYLPEGGADDVASSSSGASGNSSPHNHPLPSSASSSVSSSGVSSASASSASSSSSASSDGASSAASQSPNTTTSSATQTPMQSPLPTDQVLYALYEWVRMYQSQQSAPQIFQYPPPSPSCNFTGGDVFFPHGHPNPNSNPHPRTPRTSVSFSSGEEYNFFRQQQPQPHPSYPAPSTPQPMPPQSAPPMHCSHSYPQQSAHMMPHHSAPFGMGGTYYAGYTPPPTPNTASAGTSSSSAAFGWHGHPHSPFTSTSTPLSAPVAPKMRLQRSQSDAARRKRLTSTGEDEREYQSDHEATWDEFGDRYDNFTAGRERLQEFNGRIPPRKKKSSNSHSSSSNNPVCHTDSQPGGTSQAESGAIHGHISQQRQVERERQKAKAEKKKPQSFTWPTVVTVFVLAMGCGFFAAR diap1-rpr-3 The DIAP1 protein interacts with the Reaper (Rpr) protein 172954 N/A 172955 unspecified role unspecified role prey prey s35 radiolabelled 35s tagged protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 172956 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false diap1-rpr-4 The DIAP1 (Gly88Ser) protein displays reduced binding affinity for the Reaper (Rpr) protein 172954 N/A 172956 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 172955 unspecified role unspecified role prey prey s35 radiolabelled 35s tagged protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q24306:p.Gly88Ser Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The mutant DIAP1 Gly88Ser protein displayed reduced binding affinity for the Reaper (Rpr) protein compared to the wild type DIAP1 protein diap1-rpr-5 The DIAP1 (Gly269Ser) protein displays reduced binding affinity for the Reaper (Rpr) protein 172954 N/A 172956 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 172955 unspecified role unspecified role prey prey Q24306:p.Gly269Ser Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false s35 radiolabelled 35s tagged protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The mutant DIAP1 Gly269Ser protein displayed reduced binding affinity for the Reaper (Rpr) protein compared to the wild type DIAP1 protein diap1-hid-4 The DIAP1 protein interacts wih the Hid protein 172954 N/A 172955 unspecified role unspecified role prey prey s35 radiolabelled 35S labelled protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 172957 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false diap1-hid-5 The mutant DIAP1 (Gly88Ser) protein displays reduced binding affinity for the Hid protein 172954 N/A 172957 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 172955 unspecified role unspecified role prey prey s35 radiolabelled 35S labelled protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q24306:p.Gly88Ser Altered kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The mutant DIAP1 Gly88Ser protein displayed reduced binding affinity for the Hid protein compared to the wild type DIAP1 protein diap1-hid-6 The mutant DIAP1 (Gly269Ser) protein displays reduced binding affinity for the Hid protein 172954 N/A 172957 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 172955 unspecified role unspecified role prey prey s35 radiolabelled 35S labelled protein radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q24306:p.Gly269Ser Altered kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The mutant DIAP1 Gly269Ser protein displayed reduced binding affinity for the Hid protein compared to the wild type DIAP1 protein