IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ garcia_sanz-2014-9 Sin3b interacts with Myc and decreases Myc levels. human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-2 Sin3b interacts with Myc and decreases Myc levels. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation Only protein-protein interactions garcia_sanz-2014-4 Sin3b interacts with Myc and decreases Myc levels. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-6 Sin3b interacts with Myc and decreases Myc levels. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-3 Sin3b interacts with Myc and decreases Myc levels. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-7 Sin3b interacts with Myc and decreases Myc levels. rat-ur61 RAT UR61 pheochromocytoma cell ur61 UR61 -PC12/U7 -derived Rat pheochromocytoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation Only protein-protein interactions garcia_sanz-2014-10 Sin3b interacts with Myc and decreases Myc levels. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation garcia_sanz-2014-11 Sin3b interacts with Myc and decreases Myc levels. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Re-ChIp experiment - Two rounds of IPs:the Bait of the first round of IPs is taken as a Prey for the second round. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-1 Sin3b interacts with Myc and decreases Myc levels. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-5 Sin3b interacts with Myc and decreases Myc levels. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions garcia_sanz-2014-8 Sin3b interacts with Myc and decreases Myc levels. rat-ur61 RAT UR61 pheochromocytoma cell ur61 UR61 -PC12/U7 -derived Rat pheochromocytoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. Only protein-protein interactions myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA nucl_human_gene Nucleolin NCL Protein C23 gene gene human Homo sapiens Human sin3b_human Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b SIN3B KIAA0700 protein protein human Homo sapiens Human MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRKGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGTEGASSSPTEGFLLKPVFLQRNLKKFRRRWQSEQARALRGEARSSWKRLVGVESACDVDCRFKLSTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPASP cdk4_human_gene Cyclin-dependent kinase 4 Cell division protein kinase 4 CDK4 PSK-J3 gene gene human Homo sapiens Human s5a1_human_gene 3-oxo-5-alpha-steroid 4-dehydrogenase 1 SRD5A1 SR type 1 Steroid 5-alpha-reductase 1 gene gene human Homo sapiens Human hes1_human_gene HES1 HUMAN GENE gene gene human Homo sapiens Human sin3b_mouse Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b Sin3b Kiaa0700 protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFSQQCPGTSDDSADERDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVFLQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHRHFEEWHGRWLEDNVTVAAAGLVQDWLMGEEEEDMVPCKTLCETAHVHGLPVTRYRVQYSRRPASP sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS mad1_human Max dimerization protein 1 MAD Protein MAD MXD1 protein protein human Homo sapiens Human MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL ldha_human_gene Human L-lactate dehydrogenase A chain gene gene gene human Homo sapiens Human pyr1_human_gene PYR1_HUMAN_GENE/CAD gene gene human Homo sapiens Human myc_rat Myc proto-oncogene protein Myc Transcription factor p64 Proto-oncogene c-Myc protein protein rat Rattus norvegicus (Rat) Rat MPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSSSSDSLLSSESSPRATPEPLVLHEETPPTTSSDSEEEQDDEEEIDVVSVEKRQPPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQADEHKLISEKDLLRKRREQLKHKLEQLRNSGA Participates in the regulation of gene transcription. Binds DNA both in a non-specific manner and also specifically to recognizes the core sequence 5'-CAC[GA]TG-3'. Seems to activate the transcription of growth-related genes Overexpression of C-Myc is implicated in the etiology of a variety of hematopoietic tumors mint b0bnj0_rat Sin3b rCG_38713 protein protein rat Rattus norvegicus (Rat) Rat MAHAGGGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSNQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSAQKNEEKSLEHKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE myc-ncl 1779101 n/a 1779112 unspecified role unspecified role bait bait n/a 1779113 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7B-1 Tetracycline -represses Myc expression myc-ncl-1 1779101 n/a 1779114 unspecified role unspecified role bait bait n/a 1779113 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7B-2 myc-ncl-2 1779101 n/a 1779115 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role bait bait association association false false false 7B-3 Tetracycline -represses Myc expression sin3b-ncl 1779101 n/a 1779115 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779114 unspecified role unspecified role bait bait association association false false false 7B-4 myc-cdk4 1779101 n/a 1779112 unspecified role unspecified role bait bait n/a 1779116 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7B-5 Tetracycline -represses Myc expression myc-srd5a1 1779101 n/a 1779114 unspecified role unspecified role bait bait n/a 1779116 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7B-6 Tetracycline -represses Myc expression myc-ncl-3 1779101 n/a 1779117 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role bait bait association association false false false 7B-7 Tetracycline -represses Myc expression sin3b-cdk4 1779101 n/a 1779117 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779114 unspecified role unspecified role bait bait association association false false false 7B-8 sin3b-myc 1779102 n/a 1779112 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779118 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B myc-sin3b-1 1779102 n/a 1779118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1C, 3A myc-sin3b-9 1779102 n/a 1779119 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5A myc-hdac1 1779102 n/a 1779120 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey n/a 1779112 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6C myc-hdac1-1 1779103 n/a 1779120 unspecified role unspecified role prey prey n/a 1779112 unspecified role unspecified role bait bait n/a 1779114 unspecified role unspecified role prey prey association association false false false 6C-RHS sin3b-hdac1-1 1779103 n/a 1779120 unspecified role unspecified role prey prey n/a 1779114 unspecified role unspecified role bait bait n/a 1779112 unspecified role unspecified role prey prey association association false false false 6C-RHS-2 myc-sin3b-3 1779103 n/a 1779114 unspecified role unspecified role prey prey n/a 1779112 unspecified role unspecified role bait bait physical association physical association false false false 2A myc-sin3b-6 1779104 n/a 1779114 unspecified role unspecified role neutral component neutral component n/a 1779112 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2D-1 TPA (PMA) -in this instance, used to decrease Myc expression. myc-max-15 1779104 n/a 1779112 unspecified role unspecified role neutral component neutral component n/a 1779121 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2D-2 TPA (PMA) -in this instance, used to decrease Myc expression. max-mad-1 1779104 n/a 1779114 unspecified role unspecified role neutral component neutral component n/a 1779122 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 2D-3 myc-sin3b-2 1779105 n/a 1779118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1779112 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1D sin3b-myc-1 1779105 n/a 1779112 unspecified role unspecified role prey prey his or flag tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779118 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1E Origene's web site (Supplier of myc) lists two myc proteins, both human; one with an N terminal His tag (expressed in E.coli), the other with a C terminal FLAG tag (expressed in 293 cells). sin3b-myc-2 1779106 n/a 1779118 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B myc-sin3b-7 1779106 n/a 1779112 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B myc-ldha-2 1779107 n/a 1779123 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1779112 unspecified role unspecified role bait bait association association false false false 7D-1 myc-ldha-1 1779107 n/a 1779112 unspecified role unspecified role bait bait n/a 1779124 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7D-2 sin3b-ldha-1 1779108 n/a 1779114 unspecified role unspecified role bait bait n/a 1779112 unspecified role unspecified role prey prey n/a 1779123 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7D-1 O75182 decreases expression at protein level of P01106 sin3b-myc-3 1779108 n/a 1779114 unspecified role unspecified role bait bait n/a 1779112 unspecified role unspecified role prey prey n/a 1779124 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 7D-2 myc-sin3b 1779109 n/a 1779112 unspecified role unspecified role bait bait n/a 1779118 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A myc-sin3b-5 1779110 n/a 1779112 unspecified role unspecified role neutral component neutral component n/a 1779114 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2B TPA (PMA) -in this instance, used to decrease Myc expression. myc-sin3b-8 1779111 n/a 1779125 unspecified role unspecified role bait bait n/a 1779126 unspecified role unspecified role prey prey physical association physical association false false false 3B-RHS