IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ baumann-2013-1 Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch PeerJ 2013 Only protein-protein interactions imex curation baumann-2013-2 Analysis of close associations of uropod-associated proteins in human T-cells using the proximity ligation assay. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baumann T., Affentranger S., Niggli V. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving "P-ERM" have not been included (shown in Figs 2,4 and 5) as the antibody to "P-ERM" is not targetted to a specific protein, detecting phosph-Ezrin,Radixin and Moesin. verena.niggli@pathology.unibe.ch PeerJ 2013 Only protein-protein interactions imex curation flot1_human Flotillin-1 FLOT1 protein protein human Homo sapiens Human MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA flot2_human Flotillin-2 FLOT2 ESA1 M17S1 Epidermal surface antigen Membrane component chromosome 17 surface marker 1 protein protein human Homo sapiens Human MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV selpl_human P-selectin glycoprotein ligand 1 SELPLG Selectin P ligand protein protein human Homo sapiens Human MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAASNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF flot1-flot2-3 1571944 n/a 1571946 unspecified role unspecified role neutral component neutral component n/a 1571947 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1A Colocalisation was located along the plasma membrane in resting cells, and located at the plasma membrane of the tips of the uropods for the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot1-flot2-5 1571944 n/a 1571948 unspecified role unspecified role neutral component neutral component n/a 1571947 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3A Colocalisation was located along the plasma membrane in resting cells, and located at the plasma membrane of the tips of the uropods for the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot2-selplg 1571944 n/a 1571949 unspecified role unspecified role neutral component neutral component n/a 1571947 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp fig 1 flot1-flot2-4 1571945 n/a 1571947 unspecified role unspecified role neutral component neutral component n/a 1571946 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1B Colocalisation was located randomly along the plasma membrane in resting cells, and aligned linearly around the entire border of the uropod of the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells. flot1-flot2-6 1571945 n/a 1571947 unspecified role unspecified role neutral component neutral component n/a 1571948 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3B Colocalisation was located randomly along the plasma membrane in resting cells, and aligned linearly around the entire border of the uropod of the chemokine SDF-1 (Stromal cell derived factor 1) stimulated cells.