HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html suzuki-2013-6 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation suzuki-2013-2 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation suzuki-2013-4 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation suzuki-2013-5 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. complementation protein complementation assay PCA complementation tag fluorescence tag visualisation by fluorescence tag fluorescence Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation suzuki-2013-1 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation suzuki-2013-3 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Virus - Publications including interactions involving viral proteins Only protein-protein interactions imex curation q99ib8-pro_0000045597 Viroporin p7 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV ALEKLVVLHAASAANCHGLLYFAIFFVAAWHIRGRVVPLTTYCLTGLWPFCLLLMALPRQAYA 751 813 spcs1_human Signal peptidase complex subunit 1 SPCS1 SPC12 Microsomal signal peptidase 12 kDa subunit HSPC033 protein protein human Homo sapiens Human MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 q99ib8-pro_0000045598 Protease NS2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV YDAPVHGQIGVGLLILITLFTLTPGYKTLLGQCLWWLCYLLTLGEAMIQEWVPPMQVRGGRDGIAWAVTIFCPGVVFDITKWLLALLGPAYLLRAALTHVPYFVRAHALIRVCALVKQLAGGRYVQVALLALGRWTGTYIYDHLTPMSDWAASGLRDLAVAVEPIIFSPMEKKVIVWGAETAACGDILHGLPVSARLGQEILLGPADGYTSKGWKLL 814 1030 spcs1-e2-1 1457981 n/a P7 1457987 unspecified role unspecified role ancillary ancillary n/a SPCS1 1457988 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a E2 1457989 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6B, 6C and S2 spcs1-e2-ns2-1 1457981 n/a SPCS1 1457988 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a NS2 1457990 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a E2 1457989 unspecified role unspecified role prey prey association association false false false Fig. 6A ns2-e2-2 1457981 n/a NS2 1457990 unspecified role unspecified role bait bait n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a E2 1457989 unspecified role unspecified role prey prey physical association physical association false false false Fig. 6A ns2-spcs1-1 1457982 n/a SPCS1 1457988 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS2 1457990 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1B and 1E spcs1-ns2-1 1457982 n/a NS2 1457990 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a SPCS1 1457988 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1B and 1F q99ib8_pro-spcs1-2 1457983 n/a SPCS1 1457988 unspecified role unspecified role neutral component neutral component c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a NS2 1457990 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 1G q99ib8_pro-spcs1-1 1457983 n/a SPCS1 1457988 unspecified role unspecified role neutral component neutral component n/a E2 1457989 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. S3 ns2-spcs1-3 1457984 n/a NS2 1457990 unspecified role unspecified role neutral component neutral component mkg-c tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SPCS1 1457988 unspecified role unspecified role neutral component neutral component mkg-n tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1H e2-spcs1-1 1457984 n/a E2 1457989 unspecified role unspecified role neutral component neutral component mkg-c tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SPCS1 1457988 unspecified role unspecified role neutral component neutral component mkg-n tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. S3 ns2-spcs1-4 1457985 n/a NS2 1457990 unspecified role unspecified role bait bait cub cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a SPCS1 1457988 unspecified role unspecified role prey prey nub nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Results ns2-spcs1-2 1457986 n/a SPCS1 1457988 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a NS2 1457990 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1C