UniProt UniProt http://www.uniprot.org min-2013-2 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-3 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-5 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-9 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. In Supplementary Figure 3A/B (HMGB1 is colocalized with LC3B, an autophagy marker molecule, and also with some 97Q-GFP aggregates ); HTT is detected by tag fluorescence and the other two molecules by PLA. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-6 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. MEF hmgb1-/- cells jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-7 mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy immunostaining immunostaining Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-8 mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-10 mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. Mouse embryonic primary striatal neuronal cells jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation min-2013-11 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Min HJ., Ko EA., Wu J., Kim ES., Kwon MK., Kwak MS., Choi JE., Lee JE., Shin JS. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Huntington's - Publications describing interactions involved in Huntington's disease Affinomics - Interactions curated for the Affinomics consortium. jsshin6203@yuhs.ac Journal of immunology (Baltimore, Md. : 1950) 2013 IMEx mimix curation Only protein-protein interactions imex curation imex curation hd_human Huntingtin HTT IT15 HD Huntington disease protein protein protein human Homo sapiens Human MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV hmgb1-htt-1 1856860 N/A 1856870 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3A, supplemental 1A and 2C trichostatin A hmgb1-htt-5 1856860 N/A 1856870 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization false false false 6b htt-hmgb1-5 1856861 N/A 1856870 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false disease polyQ extension P42858:p.Gln18[25] mutation mutation certain certain sequence position certain certain certain sequence position certain false normal polyQ extension N/A 1856871 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hmg_box_domain 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false hmg_box_domain 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B and D htt-hmgb1-2 1856861 N/A 1856870 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false disease polyQ extension N/A 1856871 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false 6A hmgb1-htt-3 1856862 N/A 1856870 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3C hmgb1-htt-2 1856862 N/A 1856872 unspecified role unspecified role neutral component neutral component N/A 1856871 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false supplemental 3A hmgb1-htt-4 1856863 N/A 1856870 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component purified purified region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization false false false 6c hmgb1-htt-10 1856863 N/A 1856872 unspecified role unspecified role neutral component neutral component N/A 1856870 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp 3A htt-hmgb1-1 1856864 N/A 1856870 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false disease polyQ extension N/A 1856871 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hmg_box_domain 2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false hmg_box_domain 1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B and D hmgb1-htt-7 1856865 N/A 1856870 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 7A hmgb1-htt-6 1856866 N/A 1856870 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1856871 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 9D htt-hmgb1-3 1856867 N/A 1856870 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false disease polyQ extension N/A 1856871 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 9E hmgb1-htt-8 1856868 N/A 1856870 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component purified purified region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization false false false 9I hmgb1-htt-9 1856869 N/A 1856870 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P42858:p.Gln18[97] mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 1856871 unspecified role unspecified role neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region rhodamine label rhodamine label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. colocalization colocalization false false false 7E