IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ seo-2011-4 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-9 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-1 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. mouse-testis Mus musculus testis testis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-2 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. mouse-testis Mus musculus testis testis tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-3 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-5 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. mouse-testis Mus musculus testis testis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-6 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. mouse-eye Mouse EYE eye EYE molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-7 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-8 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes seo-2011-10 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation Diabetes - Interactions investigated in the context of Diabetes pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE lztl1_human Leucine zipper transcription factor-like protein 1 LZTFL1 protein protein human Homo sapiens Human MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA smo_mouse Smoothened homolog Smo Smoh protein protein mouse Mus musculus Mouse MAAGRPVRGPELAPRRLLQLLLLVLLGGPGRGAALSGNVTGPGPHSASGSSRRDVPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANMWLVEAEISPELEKRLGRKKKRRKRKKEVCPLRPAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGESCRQGAWTLVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAEILDADSDF bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 bbs5_mouse Bardet-Biedl syndrome 5 protein homolog Bbs5 protein protein mouse Mus musculus Mouse MSVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS lztl1_mouse Leucine zipper transcription factor-like protein 1 Lztfl1 protein protein mouse Mus musculus Mouse MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEETFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKLERVLQDLQLDQENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYESED pthb1_mouse Protein PTHB1 Bbs9 Pthb1 Bardet-Biedl syndrome 9 protein homolog Parathyroid hormone-responsive B1 gene protein homolog protein protein mouse Mus musculus Mouse MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLNIGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVSSTLDSVSQATNVEPGADSVPSITVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTDRNPDGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFELRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQVIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQELGWEETVDAAIAYLLKTCLSKSSKEQALNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPGGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPEVSARQGVLE ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS bbs9-lztfl1 1295685 n/a 1295695 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295696 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1C lztfl1-bbs9 1295685 n/a 1295695 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295696 unspecified role unspecified role bait bait c_terminal_region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 1D lztfl1-lztl1 1295685 n/a 1295696 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295696 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2D lztfl1-lztfl1-1 1295685 n/a 1295696 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295695 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S2F bbs1-smo 1295686 n/a 1295697 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295698 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4C bbs4-smo-1 1295686 n/a 1295699 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295698 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4C bbs5-smo 1295686 n/a 1295698 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false wr_containing_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1295700 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4C/D bbs7-smo 1295686 n/a 1295701 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295698 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false wr_containing_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 4C/D bbs4-bbs1-1 1295687 n/a 1295702 unspecified role unspecified role prey prey n/a 1295703 unspecified role unspecified role prey prey n/a 1295704 unspecified role unspecified role prey prey n/a 1295699 unspecified role unspecified role bait bait n_terminal_gfp_tev_s_tap_tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig S1B bbs4-bbs1-1 1295688 n/a 1295705 unspecified role unspecified role prey prey n/a 1295706 unspecified role unspecified role prey prey n/a 1295707 unspecified role unspecified role prey prey n/a 1295708 unspecified role unspecified role prey prey n/a 1295699 unspecified role unspecified role bait bait n_terminal_gfp_tev_s_tap_tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1295702 unspecified role unspecified role prey prey n/a 1295703 unspecified role unspecified role prey prey n/a 1295704 unspecified role unspecified role prey prey association association false false false Fig 1A , Table S1. lztfl1-bbs2-1 1295689 n/a 1295696 unspecified role unspecified role bait bait flag_s_tap_tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295695 unspecified role unspecified role prey prey n/a 1295709 unspecified role unspecified role prey prey n/a 1295696 unspecified role unspecified role prey prey n/a 1295701 unspecified role unspecified role prey prey association association false false false Fig 1B , Table S2. bbs4-bbs1-1 1295690 n/a 1295702 unspecified role unspecified role neutral component neutral component n/a 1295699 unspecified role unspecified role neutral component neutral component n/a 1295706 unspecified role unspecified role neutral component neutral component n/a 1295703 unspecified role unspecified role neutral component neutral component n/a 1295708 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig 1E The peak of LZTFL1 was separated from that of the BBSome. bbs4-bbs1-1 1295691 n/a 1295703 unspecified role unspecified role neutral component neutral component n/a 1295708 unspecified role unspecified role neutral component neutral component n/a 1295706 unspecified role unspecified role neutral component neutral component n/a 1295699 unspecified role unspecified role neutral component neutral component n/a 1295702 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig 1E The peak of LZTFL1 was well separated from that of the BBSome. bbs9-lztfl1-1 1295692 n/a 1295695 unspecified role unspecified role neutral component neutral component n/a 1295696 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 2C bbs9-lztfl1-2 1295693 n/a 1295696 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1295695 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 2E Over-expression of wild-type LZTFL1 inhibited ciliary localization of BBS9. Removal of the N-terminal 70 amino acids from LZTFL1 and the KR mutation increase ciliary localisation. lztfl1-lztfl1 1295694 n/a 1295696 unspecified role unspecified role prey prey Stoichiometry: 2.0 physical association physical association false false false Fig S2E