IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kawano-2012-1 HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp J. Appl. Physiol. (8750-7587) 2012 Only protein-protein interactions imex curation kawano-2012-2 HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp J. Appl. Physiol. (8750-7587) 2012 Only protein-protein interactions imex curation hspb1_rat Heat shock protein beta-1 Heat shock 27 kDa protein Hspb1 Hsp27 protein protein rat Rattus norvegicus (Rat) Rat MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTLARPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSGAK desm_rat Desmin Des protein protein rat Rattus norvegicus (Rat) Rat MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYFEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL des-hspb1 1433095 n/a 1433097 unspecified role unspecified role neutral component neutral component possible_phospho_ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n/a 1433098 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 8 Interaction is enhanced in muscle under mechanical stress. des-hspb1-1 1433096 n/a 1433098 unspecified role unspecified role neutral component neutral component n/a 1433097 unspecified role unspecified role neutral component neutral component possible_phospho_ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 7 Interaction is enhanced in muscle under mechanical stress.