IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lobysheva-2011-1 Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation Only protein-protein interactions lobysheva-2011-2 Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. mouse-endothelium Mus musculus endothelium Endothelial cells [endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. Aortic endothelial cells. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation Only protein-protein interactions cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI ncf1_mouse Neutrophil cytosol factor 1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K Ncf1 protein protein mouse Mus musculus Mouse MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV cav1-ncf1 1480989 n/a 1480991 unspecified role unspecified role neutral component neutral component n/a 1480992 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3A, Supp fig 5. Angiotensin II; the signal doubled after 15 minutes of AII stimulation. Cav-1 siRNA cav1-ncf1-1 1480990 n/a 1480993 unspecified role unspecified role neutral component neutral component n/a 1480994 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5A Angiotensin II; the signal doubled after 15 minutes of AII stimulation. The PLA signal was suppressed in Cav-1+/− ECs (Figure 5A and 5B, left) and, contrary to control cells, was not increased under AII stimulation.