IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sorokina-2011-2 Intracellular targeting of peroxiredoxin 6 to lysosomal organelles requires MAPK activity and binding to 14-3-3ε. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Sorokina E.M., Feinstein S.I., Zhou S., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations meant to indicate subcellular localization were not curated. Origin of GFP-PRDX6 constructs taken from PMID:12193653 (found through PMID:19700648, cited in the publication). Origin of 14-3-3e constructs given by authors upon email request and taken from PMID:20679398. abf@mail.med.upenn.edu Am. J. Physiol., Cell Physiol. (0363-6143) 2011 Only protein-protein interactions imex curation sorokina-2011-1 Intracellular targeting of peroxiredoxin 6 to lysosomal organelles requires MAPK activity and binding to 14-3-3ε. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Sorokina E.M., Feinstein S.I., Zhou S., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations meant to indicate subcellular localization were not curated. Origin of GFP-PRDX6 constructs taken from PMID:12193653 (found through PMID:19700648, cited in the publication). Origin of 14-3-3e constructs given by authors upon email request and taken from PMID:20679398. abf@mail.med.upenn.edu Am. J. Physiol., Cell Physiol. (0363-6143) 2011 Only protein-protein interactions imex curation sorokina-2011-3 Intracellular targeting of peroxiredoxin 6 to lysosomal organelles requires MAPK activity and binding to 14-3-3ε. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sorokina E.M., Feinstein S.I., Zhou S., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations meant to indicate subcellular localization were not curated. Origin of GFP-PRDX6 constructs taken from PMID:12193653 (found through PMID:19700648, cited in the publication). Origin of 14-3-3e constructs given by authors upon email request and taken from PMID:20679398. abf@mail.med.upenn.edu Am. J. Physiol., Cell Physiol. (0363-6143) 2011 Only protein-protein interactions imex curation sorokina-2011-4 Intracellular targeting of peroxiredoxin 6 to lysosomal organelles requires MAPK activity and binding to 14-3-3ε. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sorokina E.M., Feinstein S.I., Zhou S., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations meant to indicate subcellular localization were not curated. Origin of GFP-PRDX6 constructs taken from PMID:12193653 (found through PMID:19700648, cited in the publication). Origin of 14-3-3e constructs given by authors upon email request and taken from PMID:20679398. abf@mail.med.upenn.edu Am. J. Physiol., Cell Physiol. (0363-6143) 2011 Only protein-protein interactions imex curation sorokina-2011-5 Intracellular targeting of peroxiredoxin 6 to lysosomal organelles requires MAPK activity and binding to 14-3-3ε. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Sorokina E.M., Feinstein S.I., Zhou S., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations meant to indicate subcellular localization were not curated. Origin of GFP-PRDX6 constructs taken from PMID:12193653 (found through PMID:19700648, cited in the publication). Origin of 14-3-3e constructs given by authors upon email request and taken from PMID:20679398. abf@mail.med.upenn.edu Am. J. Physiol., Cell Physiol. (0363-6143) 2011 Only protein-protein interactions imex curation prdx6_human Peroxiredoxin-6 PRDX6 AOP2 KIAA0106 Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase 24 kDa protein Liver 2D page spot 40 Red blood cells page spot 12 Glutathione-dependent peroxiredoxin Lysophosphatidylcholine acyltransferase 5 protein protein human Homo sapiens Human MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ prdx6_rat Peroxiredoxin-6 Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase Thiol-specific antioxidant protein Prdx6 Aipla2 Aop2 Tsa Glutathione-dependent peroxiredoxin Lysophosphatidylcholine acyltransferase 5 protein protein rat Rattus norvegicus (Rat) Rat MPGGLLLGDEAPNFEANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPEEEAKQLFPKGVFTKELPSGKKYLRYTPQP 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ prdx6-ywhae-1 1438908 n/a 1438913 unspecified role unspecified role neutral component neutral component n/a 1438914 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6b H7 (PKC inhibitor), PD98059 (ERK1/2 inhibitor). prdx6-ywhae-2 1438908 n/a 1438915 unspecified role unspecified role neutral component neutral component lysosome-targeting domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1438914 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7a prdx6-ywhae 1438909 n/a 1438913 unspecified role unspecified role neutral component neutral component n/a 1438914 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6a prdx6-ywhae-3 1438910 n/a 1438915 unspecified role unspecified role neutral component neutral component lysosome-targeting domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O35244:p.Ser32Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a 1438914 unspecified role unspecified role neutral component neutral component physical association physical association false false false 7b, 7c ywhae-prdx6 1438911 n/a 1438916 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1438915 unspecified role unspecified role prey prey O35244:p.Ser32Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 8a ywhae-prdx6-1 1438912 n/a 1438916 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1438915 unspecified role unspecified role prey prey O35244:p.Ser32Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1438912 8b, 8c Kd values were 0.6 mM and 1.05 mM for 14-3-3ε interaction with wild-type and S32 mutant Prdx6, respectively.