IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2010e-2 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. chen-2010e-1 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. chen-2010e-5 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. chen-2010e-6 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. chen-2010e-3 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. chen-2010e-4 Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD p29846-pro_0000037676 Non-structural protein 5A protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) SGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQLTGHVKNGSMRIWGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVRRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVSFQVGLNQYVVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSALSLKAACTTRHTPPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLRAEEDEREVSVPAEILRKSRKFPPALPVWARPDYNPPLLEPWKDPDYVPPVVHGCPLPPVKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSESSAAGSGTATAPPDQPSDDGDAGSDVESCSSMPPLEGEPGDPDLSDGSWSTVSEEDGEGVICC 1973 2419 p29846-pro_0000037677 RNA-directed RNA polymerase protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQKKVTIDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSGKAINHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKSKKCPMGFSYDTRCFDSTVTESDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDLPQPEYDQELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWATARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRAWRHRARSVRAKLLSQGGRAATCGRYLFNWAVKTKLKLTPIPAASQLDLSKWFVAGYGGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR 2420 3010 p29846-pro_0000037673 Serine protease/helicase NS3 protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) APITAYAQQTRGLFGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWHAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT 1027 1657 hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD p29846-pro_0000037675 Non-structural protein 4B protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) ASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRTLEAFWANDMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLTTQSTLLFNILGGWVAAQLAPPGAASAFVGAGIAGAAVGSIGLGKVLVDMVAGYGAGVAGALVAFKVMSGEMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVDPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSGLTITQLLRRLHQWINEDCSTPC 1712 1972 polg-hspa2-2 1530469 n/a 1530475 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530476 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false p_cluster_isdr_pkr_binding_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2A, 3, 5A In cells containing NS5A deletion mutants D3, D4, and D5, the interaction was significantly reduced. hspa1a-polg 1530469 n/a 1530476 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1530475 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2B, 5A p29846_pro-hspa1a 1530469 n/a 1530475 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530477 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5A hspa1a-p29846_pro 1530469 n/a 1530475 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530477 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5A hspa1a-p29846_pro-1 1530469 n/a 1530478 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1530475 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5Ai p29846_pro-hspa1a-1 1530469 n/a 1530478 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1530475 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5Ai polg-hspa2 1530470 n/a 1530476 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1530475 unspecified role unspecified role prey prey n/a 1530479 unspecified role unspecified role prey prey association association false false false 1A polg-hspa2-1 1530470 n/a 1530475 unspecified role unspecified role prey prey n/a 1530479 unspecified role unspecified role prey prey n/a 1530480 unspecified role unspecified role bait bait n_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false 1Ai Weak interaction, TAP-Flag-NS4B is stated to be a purification control. p29846_pro-hspa1a-5 1530471 n/a 1530477 unspecified role unspecified role prey prey n/a 1530478 unspecified role unspecified role prey prey n/a 1530475 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530476 unspecified role unspecified role bait bait association association false false false 6A Overexpression of Hsp72 significantly increased the amounts of NS3 and NS5B complexed with NS5A p29846_pro-hspa1a-4 1530471 n/a 1530478 unspecified role unspecified role prey prey n/a 1530476 unspecified role unspecified role bait bait physical association physical association false false false 6Ai p29846_pro-p29846_pro-2 1530472 n/a 1530475 unspecified role unspecified role neutral component neutral component c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530476 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6Bi p29846_pro-hspa1a-7 1530472 n/a 1530478 unspecified role unspecified role prey prey n/a 1530476 unspecified role unspecified role bait bait proximity proximity close-contact colocalization neighbourhood interaction false false false 6C Overexpression of Hsp72 significantly increased the signal. polg-hspa2-3 1530473 n/a 1530475 unspecified role unspecified role prey prey n/a 1530476 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2C hspa1a-p29846_pro-6 1530474 n/a 1530476 unspecified role unspecified role prey prey n/a 1530478 unspecified role unspecified role prey prey n/a 1530475 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1530477 unspecified role unspecified role prey prey association association false false false 5Bi