IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Nature medicine 2013 imex curation Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease It has been assumed the same cells were used in fig 3E and Supp fig 6, but no cell line ot type is stated for Fig 3E. CD4+ T cells expressing various FOXP3 mutants Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Accepted 2016-MAR-22 AT 14:41 GMT AT 14:41 GMT by PPORRAS Nature medicine 2013 Only protein-protein interactions imex curation imex curation Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Nature medicine 2013 imex curation Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease This assay is stated to detect dephosphorylation of peptides by measuring "absorbance at 650nm": the assay method is most likely based on the formation of a complex between malachite green molybdate and free orthophosphate that absorbs at 620-640 nm. Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Accepted 2016-MAR-22 AT 14:41 GMT AT 14:41 GMT by PPORRAS Nature medicine 2013 Only protein-protein interactions imex curation imex curation Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-α in rheumatoid arthritis. Nature medicine 2013 imex curation Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com 11-Apr-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease Treg cells (CD4+CD25hiCD127lo/−) Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Accepted 2016-MAR-22 AT 14:41 GMT AT 14:41 GMT by PPORRAS Nature medicine 2013 Only protein-protein interactions imex curation imex curation il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP DIP protein Q9BZS1 original sequence version: 139 DIP protein Q9BZS1 original sequence version: 131 91737C3CEA665A15 b6zgu2_human NR2F6 protein protein human Homo sapiens Human MVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRTIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHGFFPELPVADQVALLRMSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ 02E81D961B34D758 pp1a_rabit Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK 60C37E1AD9831DAC pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK DIP protein P62136 original sequence version: 72 DIP protein P62136 original sequence version: 76 DIP protein P62136 original sequence version: 123 DIP protein P62136 original sequence version: 126 DIP protein P62136-1 original sequence version: 98 60C37E1AD9831DAC foxp3-il2_human_gene-3 1 5 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:21:19 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'ser418ala' Q9BZS1:p.[Ser418Ala;Ser422Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Fri Jul 22 10:54:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'undefined mutation' Wed May 02 19:17:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser418ala,ser422ala' Tue Jun 30 17:43:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser418Ala;Ser422Ala]' 4 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3E, supp fig 6 Q9BZS1 inhibits expression at RNA level of ENSG00000109471 mRNA and protein expression of the S418A FOXP3 mutant is not decreased by binding to IL2 promoter. CHEBI:10037 decreases expression at protein level of P62136 foxp3-ppp1ca-1 3 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 5B ppp1ca-foxp3-1 3 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 5B foxp3-ppp1ca-2 2 5 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ser418 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm undefined mutation mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:25 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'ser418ala' chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation 5D foxp3-ppp1ca-3 2 6 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain thr81 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation 5D-2 Control peptide assay;(KRpTIRR) The equivalent curated Swiss-Prot entry (P10588) for the control peptide records a "sequence confilict" and the equivalent sequence is stated as KRSIRR.