IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Cancer cell 2016 imex curation Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer lstaudt@mail.nih.gov 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-tmd8 human-TMD8-diffuse large B cell lymphoma, activated B cell-like (ABC) subtype Human tmd8 TMD8-diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Accepted 2016-MAY-20 AT 13:27 BST AT 13:27 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Missing interaction from fig 3A cloned to here. Fig 3E only gives ubiquitination - other bands are from cell lysates only. i have removed the word "another" and altered the antagonist annotation wording.; Again 3E shows ubiquitination (or lack of it) only. I have altered the SMAC annotation wording as before. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Cancer cell 2016 imex curation Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer lstaudt@mail.nih.gov 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Accepted 2016-MAY-20 AT 13:27 BST AT 13:27 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Missing interaction from fig 3A cloned to here. Fig 3E only gives ubiquitination - other bands are from cell lysates only. i have removed the word "another" and altered the antagonist annotation wording.; Again 3E shows ubiquitination (or lack of it) only. I have altered the SMAC annotation wording as before. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Cancer cell 2016 imex curation Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer lstaudt@mail.nih.gov 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Accepted 2016-MAY-20 AT 13:27 BST AT 13:27 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Missing interaction from fig 3A cloned to here. Fig 3E only gives ubiquitination - other bands are from cell lysates only. i have removed the word "another" and altered the antagonist annotation wording.; Again 3E shows ubiquitination (or lack of it) only. I have altered the SMAC annotation wording as before. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Targeting Non-proteolytic Protein Ubiquitination for the Treatment of Diffuse Large B Cell Lymphoma. Cancer cell 2016 imex curation Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer lstaudt@mail.nih.gov 22-Jun-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer I have left this an an ELISA rather than Solid Phase assay - as the methods section on the suppliers web site sounds very like ELISA -minus washing stages ++. lstaudt@mail.nih.gov Accepted 2016-MAY-20 AT 13:27 BST AT 13:27 BST by ORCHARD Cancer cell 2016 Only protein-protein interactions imex curation imex curation Missing interaction from fig 3A cloned to here. Fig 3E only gives ubiquitination - other bands are from cell lysates only. i have removed the word "another" and altered the antagonist annotation wording.; Again 3E shows ubiquitination (or lack of it) only. I have altered the SMAC annotation wording as before. malt1_human Mucosa-associated lymphoid tissue lymphoma translocation protein 1 MALT lymphoma-associated translocation Paracaspase MALT1 MLT protein protein human Homo sapiens Human MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK DIP protein Q9UDY8 original sequence version: 90 DIP protein Q9UDY8-1 original sequence version: 129 28AFB80DA025F8AB q00653-pro_0000030322 Nuclear factor NF-kappa-B p52 subunit NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 protein Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLA 1 454 76060FB800102EBE relb_human Transcription factor RelB RELB I-Rel protein protein human Homo sapiens Human MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT C2C61C2C8640513E bcl10_human B-cell lymphoma/leukemia 10 BCL10 CIPER CLAP Cellular homolog of vCARMEN Mammalian CARD-containing adapter molecule E10 Cellular-E10 CARD-like apoptotic protein B-cell CLL/lymphoma 10 CED-3/ICH-1 prodomain homologous E10-like regulator CARD-containing molecule enhancing NF-kappa-B protein protein human Homo sapiens Human MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ DIP protein O95999 original sequence version: 69 DIP protein O95999 original sequence version: 122 DIP protein O95999 original sequence version: 60 DIP protein O95999 original sequence version: 86 F87C97F2B784BA4B nf-kb consensus site probe ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) GGGACTTTCC nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE DIP protein Q9Y6K9 original sequence version: 85 DIP protein Q9Y6K9 original sequence version: 118 DIP protein Q9Y6K9 original sequence version: 123 DIP protein Q9Y6K9 original sequence version: 141 DIP protein Q9Y6K9 original sequence version: 125 DIP protein Q9Y6K9 original sequence version: 156 DIP protein Q9Y6K9 original sequence version: 83 DIP protein Q9Y6K9 original sequence version: 132 DIP protein Q9Y6K9 original sequence version: 124 DIP protein Q9Y6K9 original sequence version: 90 322D1037881447FF birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS C1778D328063586D p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A shrpn_human Sharpin SHARPIN SIPL1 Shank-associated RH domain-interacting protein Shank-interacting protein-like 1 PSEC0216 protein protein human Homo sapiens Human MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST DIP protein Q9H0F6 original sequence version: 80 DIP protein Q9H0F6 original sequence version: 89 DIP protein Q9H0F6-1 original sequence version: 68 DIP protein Q9H0F6 original sequence version: 68 DIP protein Q9H0F6-1 original sequence version: 72 DIP protein Q9H0F6 original sequence version: 91 33EE4BF66936AB60 rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV 03E1033BDF7B1B30 birc3_human Baculoviral IAP repeat-containing protein 3 Inhibitor of apoptosis protein 1 TNFR2-TRAF-signaling complex protein 1 IAP homolog C Apoptosis inhibitor 2 RING finger protein 49 BIRC3 API2 MIHC RNF49 RING-type E3 ubiquitin transferase BIRC3 Cellular inhibitor of apoptosis 2 protein protein human Homo sapiens Human MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDLLNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS DIP protein Q13489 original sequence version: 127 8581A00BA9AAB4A7 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 24tr2rqr-1 2 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Supp 4B Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. malt1-bcl10-4 1 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association 3A malt1-bcl10-5 2 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 4A, Supp 4 SM-164 - a small molecule SMAC Mimetic AT-406 - a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. ikbkg-bcl10-1 1 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 4A Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. ikbkg-bcl10-2 3 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y6K9:p.Leu329Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L P Wed May 02 15:20:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro' Tue Jun 30 20:15:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu329Pro' 8 unspecified role unspecified role prey prey physical association physical association 4E malt1-bcl10-6 2 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 5C, Supp 5C SM-164 -a small molecule SMAC Mimetic AT-406 -a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. sharpin-birc2-1 1 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association 5C Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. nf_kb consensus site probe-rela-1 4 16 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype 9 unspecified role unspecified role bait bait physical association physical association 6B-1 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. nf_kb consensus site probe-nfkb1-1 4 12 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype 9 unspecified role unspecified role bait bait physical association physical association 6B-2 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. nf_kb consensus site probe-nfkb1-2 4 6 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype 9 unspecified role unspecified role bait bait physical association physical association 6B-3 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. A NIK inhibitor nf_kb consensus site probe-nfkb2-1 4 7 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype 9 unspecified role unspecified role bait bait physical association physical association 6B-4 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. A NIK inhibitor nf_kb consensus site probe-relb-1 4 14 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype 9 unspecified role unspecified role bait bait physical association physical association 6B-5 ikbkg-malt1-2 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Supp 4B ikbkg-bcl10-3 2 13 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 5A, Supp 5A SM-164 - a small molecule SMAC Mimetic AT-406 - a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. sharpin-malt1-1 2 13 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O95999:p.[Lys31Arg;Lys63Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Wed May 02 14:59:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys31arg,lys63arg' Tue Jun 30 19:32:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys31Arg;Lys63Arg]' physical association physical association Supp 5 B The SHARPIN-MALT1 association was equivalent in cells expressing either WT or 2KR BCL10 malt1-bcl10-7 1 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association 3Ai