IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer In some EMSAs a p65/p50 heterodimer was used and sometimes p65 alone - the reason for this is not stated. Figure 4D has probably been misidentified in the figure legend as an "RNA-Pulldown" whereas it is most likely an EMSA, due to the presence on the image of a "free-probe". Figure 4D image legend is identical to that shown for figure 4E -another RNA Pulldown. Results have been entered from figure 4D as an EMSA. ? to remove ALL p50 from EMSAs where it was added? depending on email reply, if any. P50 only binds to NKILA in presence of p65. So what role if any does it play if present? The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer NKILA was detected by FISH -using an anti-NKILA oligodeoxynucleotide probe conjugated to Alexa Fluor 488. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-JUL-06 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay elisa enzyme linked immunosorbent assay ELISA ELISA elisa Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Phosphorylation of IκBα was detected by immunoblotting or ELISA. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer songew@mail.sysu.edu.cn Accepted 2015-JUL-22 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay antibody detection identification by antibody antibody detection Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer It has been assumed that p65 is present in figures 6c and 6d. Phosphorylation of IκBα was detected by immunoblotting or ELISA. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cleavage cleavage assay cleavage tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer I have entered results from RNAse V1 (from cobra venom - presumably the Caspian cobra -Naja oxiana) - the suppliers Data sheet only states "cobra venom" - but googling V1 RNase says "Naja oxiana". Hope this is OK. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-JUL-06 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer p65 (RELA) has been entered with a GST tag and amino acids 1-306, as this is the only p65 recombinant protein on Sino Biological's web site. Reconbinant IKBA (Abcam) has been entered here without a His-tag, but it is possible the his-tagged protein was used throughout. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Results from Figure 5B have not been entered; these results are stated to show how point mutations of p65 (at the hairpin A -R33A, R35A, Y36A, and E39A or the hairpin B-binding site -K56A and K62A) disrupt interactions with NKILA - but no results from unmutated p65 are shown for comparison. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Accepted 2015-JUL-22 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro footprinting footprinting ms participant Identification by mass spectrometry ms participant Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer table S5A states MS/MS for participant detection however the reference given and elsewhere in this paper would imply Fingerprinting for detection - so have left as Ms-participant. IKBA not added as does not seem to make any difference if present of not - reacts with or without IKBA. Biotin-labeling Assay:Protein Footprinting exploits differential accessibility of the primary amine-modifying reagent N-hydroxysuccinimide (NHS)-biotin to lysine residues in the free protein versus the protein–RNA complex. Surface-exposed lysines are modified by NHS-biotin in free protein, while those coordinating RNA become shielded from modification in the nucleoprotein complex. Individual protein subunits are separated by SDS-PAGE followed by in-gel proteolysis, and subsequent MS analysis. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer Results from Figure 5B have not been entered; these results are stated to show how point mutations of p65 (at the hairpin A -R33A, R35A, Y36A, and E39A or the hairpin B-binding site -K56A and K62A) disrupt interactions with NKILA - but no results from unmutated p65 are shown for comparison. RIP-reRIP or Sequential RNA-IP; the bait for the first IP is taken as the prey for the second. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint tag visualisation tag visualisation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do NOT have polyA tails. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. A cytoplasmic NF-κB interacting long noncoding RNA blocks IκB phosphorylation and suppresses breast cancer metastasis. Cancer cell 2015 imex curation Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro enzymatic footprint enzymatic footprinting enzymatic footprint qrt-pcr quantitative reverse transcription pcr QRT-PCR Liu B., Sun L., Liu Q., Gong C., Yao Y., Lv X., Lin L., Yao H., Su F., Li D., Zeng M., Song E. Cancer - Interactions investigated in the context of cancer No reply to author email from which I make the assumption they are (deliriously) happy with the Ref-Seq identifier being used for NKILA.. I have added a "RefSeq" identifier for NKILa RNA entry - but although I do not see an error message, there is no link - I would think there should be one? - there is a link for the other 2 identifiers I entered. The Ref-Seq identifier for NKILA (NR_131157.1) has been used throughout as this is the only sequence which includes a PolyA tail; the text under Figure 2 specifically states that NKILA does have a PolyA tail. The identifier given in this publication (GenBank: AK056098.1) and also RNA central identifiers (URS000077A9EC derived from OTTHUMT00000474101.1 from Vega) do not have polyA tails. p50 (p19838-pro_0000030311) tags and expression system are not stated here and cannot be deduced from the suppliers web site. songew@mail.sysu.edu.cn Accepted 2015-AUG-10 by ORCHARD Cancer cell 2015 imex curation nkila_human_gene NKILA Human gene gene gene human Homo sapiens Human nkila NKILA -LncRNA lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human AGACCCGGCACCCGCGCAACGGAGGAGGGGCGCTGTGCCCTCTCCCCAACGGCGGTCAGCTTGGAACGCCTGCCCGGCGCACGCCCGGGGCCGGGGAGCCGAACTCGGTGCCAGCCGCACCCGGGCGGGTTGCTGGTGCGCCCTCCCCTCGCCCCCGTCCCTGGGGTCCTTGACCCAGGCTCTTGGGGCTAGCCTATCTTCTGAGGAGCACAAGGTCCCTGGGGGCTCAGGGAAGAGAAATTGGAGAAAGGGGGAGGAAGCCCCCAAGATGGATCACCCATTGCCTGGTTTCGCAGGAGACTGTCCGCCTTCAGTTCTCCAGCAGCTCGGGGATCATGGCCCACTGAACCCCCAAGCGCTTTCACCCGAACCCAAGGAGGACGACCAGGAAAGACGGGAACTCGCGTAGACACGCCCGGAAGCCCTTGTCATGTAAATAGCTGTCGGGGACTGGTGTATTGTCGCCGCCCCAGCCGGCGGGACCTGGGGCGAATCCACACCCATTGTCTGCTGCCCAAGGGGCCTCCGGCTGGGGGGCGCGGCTGCGGAGTTCAAAAGGGGTATGAGCAGGAGGGGTGTACTTTTAGTTCATTAAGTTTTAATTACAGGAGTGCTACAAGAACACATTCTTCAGGTTTAAAAAGATATTAAAATATTACATAAGAGACCTCCCCTCCCTGGCCCACCTCCAGCCTCTTAAAAATTTAGTGTGTCGCCTTTTAGACACTTTCTCAAAGCTTCACTTATTTAACAGGCACTTAAGGAGCACCTACCTGTGCCAGAAACTCTCCAAATATTAACTCAACCTGACACCGACTCAGTGTGGCCGAATATTACTCTCCCCATTTTACAGAGCGGGCAGCTGGTCAAGGAAGTCGCTTGTTGAAAGTCACACAGTGGTGGAGCCTGTGTGCCAACCCAGGACCCTGGGGAGCTGCCTCCCCCTCTCCCACGTAGTCCTGATTCTTTAAGTGTCCACATATTCCTGTAATGCCTGGAGTTTCAGTAATTAGCAGGGACTTAGTGTGTTCAGAGAAAAAAAAAGCTTTTAAAAATTATTGTTACTGTGTTTGTAACAGTTTGGATAGAGAAGGAAAAGCTGGAATTTGGGAAGTGAAGGTGGCCTCGGGGTAGAACTTACCTAGACCAGAGCGAATTCATCCTGAAGAACTCAGAGAAAGCCGGTGCAGGAAGTGGGTTCCCGCTCTCCCTGCACAGGCACAGTGATGCTGCCAGAGCTCTCCCAGAAAGACCAGGAGGCTTGTTCTGGAGAAGTCAAGCCCAGGGATGTGGCTCAGGCTGGTCCAAGCTCTTTGGAGGAGTCCAAGCGTGCCCAGCCCAGAGGGAGGTTCAGAGGCACTGACCGTCTTCTGTTTGGGAGGAGAAGCTCACTCTTGGAGCCACAGCCAGCACTAGGTCAGGACCCAGGCCCCGGCCCAGGAGTGGGGCAATACCCAGCGTCTACCCCAGATGGCACCCTGCTGTGAACTGGGCGCCCTCAGCCCCTGCCTTGAGGAAGGGGCAATACCACCAGCGTGTCTTTTATCAGGGAAGATATTGCTGCAGTTTGGCCGCTGCAACTTAAGAGAAAAGCTAAGGGGTCCCCCAGCATCCCTTGGGGTGCCACTGCAAATACTGGCTGGGCCTGGAGATGACCTGGGTCCCATTCACTTCCTAGGGTGAAGGAGGTCATCATTACCACCCCTGCTTTCAGCCATTTCTTCATTCATTCAATCAACAAACTGGCTGAGCTGCAACCCTGAGCCGGGGAATTCAGCCACTCCAGACACAGCCCCTGCCCTCCGGGAAGTCTCGGGAGACCTGGCTAGTCTGGCTGGGAGAAGTCACACGTTGATTGTCTTGGAAGTGAGATGGCATTTACACAATGGAGGCTGCACTGCCAGCAGGCAAAAATAACCAGTTAATTCAGTGGCTTAAAGAAACCAAACCTACCCACAACGCTTGACCTCCCATTGATCCATCTGCGACACCGGCAGTGGCTACCATTTATTGAGTGCTGATGGTGTCACCTGGGATTGACTTAGTGGTCTCTGGCGCTAGTTCCGAAGTTGATTCTGTCTGGAGAGCTTAATGCAGTGTTCAGACCTCAGGGTCCGAACCTGAGGGTCACCCAAAGATGAGTGGGACATAGCTGTGTGACCTCGGCTGAGTGCTTTCACCTCTCCAACCTCAGTTTCCTCTTCTGCAAAATGGGGTGGCTTCATGGCACCTTCACGTGGTGTGATTGCGAGGAATGAAGGGATCGATGCCTTGCAAGTAGAGGAGAAGGGGCCGGATACATCTTAGTTGTTATGTTATTTAATCATCTTGGCAACCCCGGGAGGGAGGAACCACTATCATTTTATTTTCCATTTTGCAGTTGAGGACAATGATGATTCCAGCACAGACAGGGCCCCTGACGGGGCAGTAGGAAAGGAGAATTGCTTTGGAAGGAGCATAGGCTGGACTGCCAGCACTCATAGGAGGCTTCGTGTGTGCCCAGGACTGCGAGAATTAAATACAGGACACCCAGTTCAGTTTGAATTTCAGATAAACTATGAATAATGATTAGTGTAAGTATATCTCAATTTAACTGGAAAAAAAAAAAAAAAAAA q04206-1 Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 p65 RELA NFKB3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206-1 original sequence version: 99 8147A6AF9F2445C6 nkila_mutb nkila_deletion_mutant B lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human TGGTTTCGCAGGAGACTGTCCGCCTTCAGTTCTCCAGCAGCTCGGGGATCATGGCCCACTGAACCCCCAAGCGCTTTCACCCGAACCCAAGGAGGACGACCAGGAAAGACGGGAACTACACGCCCGGAAGCCCTTGTCATGTAAATAGCTGT p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A nkila_probe NKILA_promoter_probe lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human CGCGCGCTGCGCCAATCCCCGCCGAGGTTC wedelolactone wedelolactone 1,8,9-trihydroxy-3-methoxycoumestan Wedelolactone 1,8,9-trihydroxy-3-methoxy-6H-[1]benzofuro[3,2-c]chromen-6-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) najox_rnase_v1 Cobra Venom RNASe V1 protein protein najox najox Central Asian cobra Oxus cobra q04864-2 Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV No experimental confirmation available. E312A59CF1D306A2 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 rnt1_aspor Guanyl-specific ribonuclease T1 rntA AO090011000118 protein protein aspor Aspergillus oryzae (strain ATCC 42149 / RIB 40) MMYSKLLTLTTLLLPTALALPSLVERACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT 3F49EF41E85E230A rnas1_bovin Ribonuclease pancreatic RNASE1 RNS1 RNase 1 RNase A protein protein bovin Bos taurus (Bovine) Bovine MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV DIP protein P61823 original sequence version: 104 74E5DC61E679187D canonical_nfkb_probe canonical_nfkb_probe lncrna long non-coding ribonucleic acid lncRNA long non coding RNA long non coding ribonucleic acid long non-coding RNA lncrna human Homo sapiens Human AGTTGAGGGGACTTTCCCAGGC ikba_human_gene NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 gene gene human Homo sapiens Human ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS DIP protein O14920 original sequence version: 89 DIP protein O14920 original sequence version: 100 DIP protein O14920 original sequence version: 121 DIP protein O14920 original sequence version: 126 DIP protein O14920 original sequence version: 136 DIP protein O14920 original sequence version: 128 DIP protein O14920-1 original sequence version: 151 DIP protein O14920 original sequence version: 142 DIP protein O14920 original sequence version: 159 DIP protein O14920 original sequence version: 93 DIP protein O14920 original sequence version: 124 DIP protein O14920-1 original sequence version: 178 DIP protein O14920 original sequence version: 85 F9CADF671AE9E14E bay-117082 Bay-117082 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 rela-nkila_human_gene-2 4 23 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1F TNF-alpha sc-3060 (CAS 213546-53-3) a small peptide inhibitor of NF-kB nuclear translocation. JSH-23 a small molecule inhibitor of NF-kB (p65) nuclear translocation. rela-nfkbia-3 4 23 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1Fi TNF-alpha sc-3060 (CAS 213546-53-3) a small peptide inhibitor of NF-kB nuclear translocation. JSH-23 a small molecule inhibitor of NF-kB (p65) nuclear translocation. nkila-rela-7 2 23 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 3C rela-nkila-2 8 15 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait association association 3D, Supp 3E p65 siRNA nfkb1-nkila-1 8 15 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association 3DI, Supp 3E p50 siRNA p65 siRNA nfkbia-nkila-3 8 15 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait association association 3Dii, Supp 3E p65 siRNA IKBA siRNA nkila-nfkb1-1 7 15 unspecified role unspecified role bait bait 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3E, Supp 6E A mutation to disrupt hairpin C in NKILA did not reduce its binding to p65. nkila-nfkb1-2 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 3E,4A,4B/D/E, Supp 4H NKILA binds to p65, but only to p50 or IkBa in the presence of p65. q04206 is required for binding of P25963 to NR_131157.1 q04206 is required for binding of P19838-PRO_0000030311 to NR_131157.1 The NKILA mutant (mA) with two point mutations:- G331C and C351G disrupted this interaction. nkila-nfkb1-3 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 3Ei,4B, Supp 4H nkila-nfkb1-4 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 3Eii, Supp 6E A mutation to disrupt hairpin C in NKILA did not reduce its binding to p65. nkila-nfkb1-5 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4Bi Mutants retaining only hairpin A, (NK322–359) and (NK286–402), bound to the p65:p50 heterodimer, as well as the p65 homodimer in the absence of IkBa, but not in the presence of IkBa. nkila-nfkb1-6 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 4Bii Mutants retaining only hairpin A, (NK322–359) and (NK286–402), bound to the p65:p50 heterodimer, as well as the p65 homodimer in the absence of IkBa, but not in the presence of IkBa. nkila-nfkb1-7 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4C nkila-nfkb1-8 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4C nkila-nfkb1-9 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4C (D) nkila-nfkb1-10 1 16 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4C (4D) nkila-nfkb1-11 7 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro physical association physical association 4E, Supp 4H. A NKILA probe with a deletion of nucleotides 403-409 still bound to p65/p50 but in the presence of IKBA this binding was reduced. Originally entered as Figure 4D with a Caution, but copied to EMSA expt: (The image legend states that this is an "RNA Pulldown" but the image itself would appear to show results from an EMSA.) nkila-rela-1 9 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain C G region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 23 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 151 146 direct interaction direct interaction 5A, Supp 5A I can see NO difference between Fig 5A and Supp 5A? (same figure?) rela-nkila-1 10 30 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey in vitro In vitro 23 unspecified role unspecified role bait bait Q04206:p.[Arg33Ala;Arg35Ala;Tyr36Ala;Glu39Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:17:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg33ala,arg35ala,tyr36ala,glu39ala' Tue Jun 30 17:25:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg33Ala;Arg35Ala;Tyr36Ala;Glu39Ala]' Q04206:p.[Lys56Ala;Lys62Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:57:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys56ala,lys62ala' Tue Jun 30 18:09:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys56Ala;Lys62Ala]' n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 5C ikbkb-nfkbia-10 5 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 6A ikbkb-nfkbia-11 5 16 stimulator stimulator ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 6Ai q04206-1 increases activity of O14920. ikbkb-nfkbia-12 5 28 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 29 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation 6A-1 CHEBI:85928 inhibits activity of O14920. bay_117082-ikbkb-1 5 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation 6A-2 CHEBI:10037 inhibits activity of O14920. ikbkb-nfkbia-13 5 15 inhibitor inhibitor neutral component neutral component g331c,c351g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain C G region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 stimulator stimulator unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 6Aii,6C/D The addition of NKILA to p65-prebound IkBa prior to active IKKb prevented in vitro IkBa phosphorylation, but adding NKILA after IKKb did not inhibit IkBa phosphorylation. A mutation to disrupt hairpin C in NKILA did not inhibit IKKb-induced IKBa phosphorylation. NR_131157 inhibits activity of O14920. NR_131157 decreases binding of O14920 to P25963 bay_117082-ikbkb-2 3 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 29 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation Supp 6A-1 ikbkb-nfkbia-14 3 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation Supp 6A-2 ikbkb-nfkbia-15 3 15 inhibitor inhibitor neutral component neutral component g331c,c351g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain C G region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 stimulator stimulator ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 227 222 phosphorylation phosphorylation reaction phosphorylation Supp 6Aii The addition of NKILA to p65-prebound IkBa prior to active IKKb prevented in vitro IkBa phosphorylation, but adding NKILA after IKKb did not inhibit IkBa phosphorylation. ikbkb-nfkbia-16 3 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supp 6A ikbkb-nfkbia-17 3 16 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 28 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 30 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser32 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 238 243 phosphorylation phosphorylation reaction phosphorylation Supp 6Ai nkila-rela-2 9 15 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain C G region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 30 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 16 ancillary ancillary neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6B, Supp 6F nkila-nfkb1-12 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 1E nkila_probe-rela-1 11 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 1E nkila_probe-rela-2 1 19 competitor competitor competitor prey prey in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 1E-1 nkila_probe-nkila_probe-1 1 19 competitor competitor competitor prey prey c17g,c18g mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain CC GG in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 1E-2 nkila_probe-nkila_probe-2 1 26 competitor competitor competitor prey prey in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 1E-3 nkila-nfkb1-13 7 23 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 30 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells association association Supp 3F p65 siRNA nkila_probe-rela-3 11 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 300 303 direct interaction direct interaction Supp 4C nkila-rela-3 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range N/A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C in vitro In vitro direct interaction direct interaction Supp 4C nkila-rela-4 1 22 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G C certain certain sequence position certain certain certain sequence position certain C G in vitro In vitro direct interaction direct interaction Supp 4C-2 rela-nkila-3 8 15 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined g331c,c351g mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C hairpin_A sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 23 unspecified role unspecified role bait bait association association Supp 4D canonical_nfkb_probe-canonical_nfkb_probe-1 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 4Ei canonical_nfkb_probe-nkila-1 1 15 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 4Eii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. canonical_nfkb_probe-nkila-2 1 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 competitor competitor competitor prey prey in vitro In vitro direct interaction direct interaction Supp 4F nkila-canonical_nfkb_probe-1 1 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 4Fi canonical_nfkb_probe-canonical_nfkb_probe-2 1 26 competitor competitor competitor prey prey in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 4Eiii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. nkila-nkila-1 1 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Supp 4Fiii The NK_286–444 probe competed more effectively for p65 than the DNA probe containing the consensus/canonical NFKB binding site. nkila-rela-5 12 15 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region binding region binding-associated region binding region range range range range in vitro In vitro 16 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 4G nkila-rela-6 12 15 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction Supp 5B nkila-rel-1 12 30 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region range range range range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction Supp 5Bi i think I can see an effect of IKBA here - a darker band in presence of IKBA, though text does not mention this inhibition for this expt. nfkbia-nkila-1 7 30 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3_prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction Supp 5C nkila-nfkbia-1 7 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 22 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction Supp 5Ci nkila-rnta-2 6 24 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) 15 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro rna cleavage rna cleavage Supp 6C RNase T1 specifically cleaves single-stranded RNA after guanosine residues. nkila-rnta-1 6 21 enzyme enzyme neutral component neutral component najox-venom najox-venom Central Asian cobra Oxus cobra venom venom 15 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro rna cleavage rna cleavage Supp 6Ci RNase V1 cleaves double-stranded RNA in a non-sequence-specific manner najox_rnase_v1-nkila-1 6 25 enzyme enzyme neutral component neutral component bovin-pancreas Bovine pancreas pancreas 15 enzyme target enzyme target substrate substrate neutral component neutral component 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro rna cleavage rna cleavage Supp 6Cii RNase A is an endonuclease that specifically cleaves 3' of U and C residues. Acts on single-stranded and double-stranded RNA. nkila-nfkbia-2 13 30 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 424 422 direct interaction direct interaction Supp 6D, Supp Table 7 nfkbia-nkila-2 13 15 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro 16 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction Supp 6D, Supp Table 7i nkila-nfkb1-14 1 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4D NKILA mutant B (deletion of nts 403-9) binds NF-kB alone, but binding is decreased in the presence of IKBA. nkila-nfkb1-15 1 30 inhibitor inhibitor prey prey ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role prey prey physical association physical association 4Di NKILA mutant B (deletion of nts 403-9) binds NF-kB alone, but binding is decreased in the presence of IKBA. nkila-rela-8 1 15 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range in vitro In vitro 16 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c351g,g331c mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C G certain certain sequence position certain certain certain sequence position certain G C in vitro In vitro direct interaction direct interaction Supp 4Ci A "consensus" NFKB probe competed effectively. The exact sequence of this probe is not stated, but sequence of the NF-kB binding consensus sequences are given above Figure 4 and are:- nt 322–332 and nt 350–359 of NKILA.