IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer The Species of CDK4 is not stated anywhere I can find - have left it out of the interactions as it's role is not stated. (previously entered as an ancillary molecule - P30285 -mouse species.) Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) Details of H4 taken from manufacturers website adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) Additional details on constructs taken from manufacturers website. adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-te7 Human TE7 esophageal cancer cell line te7 Human TE7 esophageal cancer cell line TE7 has a cyclin D1 mutation resulting in a proline to alanine substitution at position 287. P287A - a nuclear export mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions human-te3 Human TE3 esophageal cancer cell line te3 Human TE3 esophageal cancer cell line TE3 has a cyclin D1 mutation resulting in a proline to alanine substitution at position 287. P287A - a nuclear export mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase. Cancer Cell (1535-6108) 2010 imex curation Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu 06-April-2011: Contacted by JYOTI. orchard Only protein-protein interactions mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Aggarwal P., Vaites LP., Kim JK., Mellert H., Gurung B., Nakagawa H., Herlyn M., Hua X., Rustgi AK., McMahon SB., Diehl JA. Cancer - Interactions investigated in the context of cancer Cyclin D1-T286A complexes and co-purified proteins were isolated from (splenic) tumors (disseminated IgM-positive B-cell lymphoma) derived from Eu-D1T286A transgenic mice. (expression of FLAG-tagged cyclin D1/T286A was controlled by the lymphoid-specific Eu enhancer.) adiehl@mail.med.upenn.edu Accepted 2011-FEB-7 by ORCHARD. 06-April-2011: Contacted by JYOTI. Cancer Cell (1535-6108) 2010 orchard Only protein-protein interactions imex curation cul4b_mouse_gene Mouse CUL4B gene:Cullin 4B. gene gene mouse Mus musculus Mouse cul4b_human_gene Human CUL4B gene:Cullin 4B gene gene human Homo sapiens Human smca4_human Transcription activator BRG1 SMARCA4 BRG1 SNF2B SNF2L4 ATP-dependent helicase SMARCA4 SNF2-beta BAF190A Mitotic growth and transcription activator Protein BRG-1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 Protein brahma homolog 1 BRG1-associated factor 190A protein protein human Homo sapiens Human MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESRHCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein P51532 original sequence version: 125 DIP protein P51532 original sequence version: 115 DIP protein P51532 original sequence version: 154 DIP protein P51532 original sequence version: 136 DIP protein P51532-1 original sequence version: 136 ABDA5EDBF10D7D28 cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A cul4a_human_gene Human CUL4A gene:Cullin 4A gene gene human Homo sapiens Human ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A mep50_human Methylosome protein 50 WDR77 MEP50 WD repeat-containing protein 77 Androgen receptor cofactor p44 p44/Mep50 HKMT1069 Nbla10071 WD45 protein protein human Homo sapiens Human MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE DIP protein Q9BQA1 original sequence version: 79 DIP protein Q9BQA1 original sequence version: 110 DIP protein Q9BQA1-1 original sequence version: 137 DIP protein Q9BQA1 original sequence version: 105 3D355AEC68491ECB anm5_mouse Protein arginine N-methyltransferase 5 Prmt5 Jbp1 Skb1 Histone-arginine N-methyltransferase PRMT5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 protein protein mouse Mus musculus Mouse MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIANAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQVLMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL E8014CA172B30543 anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL DIP protein O14744 original sequence version: 86 DIP protein O14744 original sequence version: 104 DIP protein O14744-1 original sequence version: 148 DIP protein O14744-1 original sequence version: 114 DIP protein O14744 original sequence version: 146 522E255B384F25E7 cdk4_human Cyclin-dependent kinase 4 CDK4 Cell division protein kinase 4 PSK-J3 protein protein human Homo sapiens Human MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE DIP protein P11802 original sequence version: 177 DIP protein P11802 original sequence version: 135 DIP protein P11802 original sequence version: 136 DIP protein P11802 original sequence version: 200 DIP protein P11802 original sequence version: 86 0916A0C07403A33A cul4a_mouse_gene Mouse Cul4a gene:Cullin 4A gene gene mouse Mus musculus Mouse mep50_mouse Methylosome protein 50 Wdr77 Mep50 WD repeat-containing protein 77 protein protein mouse Mus musculus Mouse MRKDTPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGSLLLGVSSLSGRCWVGSLWFFKDPSAAPNEGFCSAGVQTEAGVADLTWVGDKGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVTVLSSGTQAVSGSKDCCIKIWDLAQQVSLNSYRAHAGQVTCVAASPHKDSVFLSCSEDSRILLWDTRCPKPASQMACNASGYLPTALAWHPQQSEVFVFGDENGSVSLVDTKNASCTLSSAVHSQGVTRLVFSPHSVPLLTSLSEDCSLAVLDSSLSEVFRSRAHRDFVRDATWSPLNHSLLTTVGWDHQVIHHVVPLEPLPNPGPDSVVE E9C52BC4D6E5AC36 h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62805 original sequence version: 68 DIP protein P62805 original sequence version: 111 DIP protein P62805 original sequence version: 94 DIP protein P62805 original sequence version: 97 DIP protein P62805 original sequence version: 116 DIP protein P62805 original sequence version: 105 DIP protein P62805 original sequence version: 120 DIP protein P62805 original sequence version: 144 DIP protein P62805 original sequence version: 150 DIP protein P62805 original sequence version: 154 DIP protein P62805 original sequence version: 156 DIP protein P62805 original sequence version: 112 DIP protein P62805 original sequence version: 121 DIP protein P62805 original sequence version: 123 DIP protein P62805 original sequence version: 126 DIP protein P62805 original sequence version: 132 DIP protein P62805 original sequence version: 136 DIP protein P62805 original sequence version: 119 A9E5DFD3F8B97598 smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein Q3TKT4 original sequence version: 82 DIP protein Q3TKT4 original sequence version: 56 DIP protein Q3TKT4 original sequence version: 43 DIP protein Q3TKT4 original sequence version: 75 C23804ED858F98FE ccnd1_mouse G1/S-specific cyclin-D1 Ccnd1 Cyl-1 protein protein mouse Mus musculus Mouse MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI DIP protein P25322 original sequence version: 139 DIP protein P25322 original sequence version: 123 DIP protein P25322 original sequence version: 75 3A79736B4163251B ccnd1-cdk4 1 26 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 22 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 29 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 20:20:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 15:58:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain association association Fig S1, Table S1. PMRT5 amino acids numbers have had +1 added to agree with UniProt sequences. cycd1-prmt5 14 22 unspecified role unspecified role prey prey 29 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:51:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 17:37:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' physical association physical association Fig 1A. mep50-cdk4-1 13 17 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey P24385:p.Pro287Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:07:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro287ala' Tue Jun 30 18:30:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro287Ala' 23 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait association association Fig 1C. mep50-cdk4-2 12 21 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey P24385:p.Pro287Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:39:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro287ala' Tue Jun 30 17:17:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro287Ala' 17 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey association association Fig 1C. prmt5-ccnd1 9 29 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:57:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 19:19:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' 21 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 1D. myc-PRMT5 - supplement refers to a Human variety of this. Dont know what the species wild type D1 is - but presumably Mouse, as the mutant form is. It is stated that "Cell culture conditions and transfections were performed as previously noted (Aggarwal et al., 2007)" - only I cannot find this info regarding the species of cDNA used in the constructs. Cyclin D1T286A was enriched in PRMT5 complexes at the G1/S boundary and declined as cells progressed through S-phase. mep50-prmt5 5 28 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:27:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 16:46:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' 26 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait association association Fig 1E. prmt5-h4 3 22 enzyme enzyme neutral component neutral component mouse-b-cell lymphoma Mus musculus B-cell lymphoma b-cell lymphoma B-cell lymphoma 27 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 3B. Four of six tumors exhibited an increase in PRMT5 activity. prmt5-h4-1 3 23 enzyme enzyme neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 27 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 3C. the only H4 from NEB is human - e.coli. PRMT5 isolated from S-phase cells expressing cyclin D1T286A exhibited enhanced methyltransferase activity; a small but significant increase was also observed in cells overexpressing wild-type cyclin D1/CDK4. h4-cul4a 6 27 unspecified role unspecified role bait bait arg4 H4R3me2a nonome2arg asymmetric dimethyl-L-arginine (2S)-2-amino-5-([(dimethylamino)(imino)methyl]amino)pentanoic acid MOD_RES Asymmetric dimethylarginine MOD_RES Omega-N-methylated arginine N5-[(dimethylamino)(imino)methyl]ornithine NG,NG-dimethylarginine asymmetric dimethylarginine omega-N,omega-N-dimethlyated L-arginine omega-N,omega-N-dimethyl-L-arginine Dimethyl NoNoMe2Arg di-Methylation certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey association association Fig 3D, 3E. A 2- to 3-fold increase in methylation of both H4R3 and H3R8 was observed at the proximal promoter regions (~500 bp upstream of the first coding exon) of CUL4A (Figure 3D) and CUL4B (Figure S3E) in the presence of cyclin D1T286A/CDK4 as compared to cyclin D1/CDK4 or untransfected controls in S-phase HeLa cells. PRMT5 knockdown attenuates methylation of H4R3 and H3R8 of CUL4A (top graph, Fig 3E) and CUL4B (bottom graph, Fig 3E) promoter regions. cul4a_ccnd1 11 25 unspecified role unspecified role prey prey 29 unspecified role unspecified role bait bait P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:02:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 18:00:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 3F. Cyclin D1T286A occupancy of both Cul4A/B promoters was observed in cyclin D1T286A-expressing primary murine lymphoma cells. cul4b_ccnd1 11 29 unspecified role unspecified role bait bait P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:37:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 19:01:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey association association Fig 3F. Cyclin D1T286A occupancy of both Cul4A/B promoters was observed in cyclin D1T286A-expressing primary murine lymphoma cells. mep50--5 8 29 unspecified role unspecified role prey prey P25322:p.Pro287Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:09:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro287ala' Tue Jun 30 15:57:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro287Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4A. mep50-ccnd1-1 2 18 unspecified role unspecified role neutral component neutral component 22 unspecified role unspecified role neutral component neutral component 28 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:24:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 17:55:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' 26 unspecified role unspecified role neutral component neutral component physical association physical association Fig S1C. CDK4 can be seen mostly in fractions 25-28, rather than 16-18. Cyclin D1/CDK4, PRMT5, MEP50, and Brg1 co-fractionate as a high molecular weight complex (fractions 16-18). Consistently, size exclusion chromatography revealed cofractionation of cyclin D1T286A, CDK4, PRMT5, MEP50, and Brg1 in murine lymphomas (Figure S1C). h4-cul4b 6 16 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait arg4 H4R3me2a nonome2arg asymmetric dimethyl-L-arginine (2S)-2-amino-5-([(dimethylamino)(imino)methyl]amino)pentanoic acid MOD_RES Asymmetric dimethylarginine MOD_RES Omega-N-methylated arginine N5-[(dimethylamino)(imino)methyl]ornithine NG,NG-dimethylarginine asymmetric dimethylarginine omega-N,omega-N-dimethlyated L-arginine omega-N,omega-N-dimethyl-L-arginine Dimethyl NoNoMe2Arg di-Methylation certain certain sequence position certain certain certain sequence position certain association association Fig S3E, 3E. A 2- to 3-fold increase in methylation of both H4R3 and H3R8 was observed at the proximal promoter regions (~500 bp upstream of the first coding exon) of CUL4A (Figure 3D) and CUL4B (Figure S3E) in the presence of cyclin D1T286A/CDK4 as compared to cyclin D1/CDK4 or untransfected controls in S-phase HeLa cells. prmt5-cul4b-1 6 23 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association Fig S3F. PRMT5 occupies the same region of the CUL4 promoters (as H4 and H3), in HeLa cells expressing cyclin D1T286A. prmt5-cul4a 6 19 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait association association Fig S3F. PRMT5 occupies the same region of the CUL4 promoters (as H4 and H3), in HeLa cells expressing cyclin D1T286A. cul4a_brg1 11 28 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey association association Fig S3G. Brg1 also occupies the Cul4A and Cul4B promoters, in cells from D1T286A lymphomas. cul4b_brg1 11 15 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait association association Fig S3G. Brg1 also occupies the Cul4A and Cul4B promoters in cells from D1T286A lymphomas. prmt5-h4-2 7 27 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) 23 enzyme enzyme neutral component neutral component n terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 21 unspecified role unspecified role ancillary ancillary n terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection methylation methylation reaction methylation Fig 5A. PRMT5-dependent methyltransferase activity was increased following a kinase reaction with purified cyclin D1T286A/CDK4. prmt5-h4-3 4 21 unspecified role unspecified role ancillary ancillary region (required) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gst or myc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BQA1:p.Thr5Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:26:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr5ala' Tue Jun 30 18:00:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr5Ala' Q9BQA1:p.Ser264Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:18:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser264ala' Tue Jun 30 18:31:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser264Ala' 23 enzyme enzyme neutral component neutral component 27 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig 5B, 5C. mep50-1 2 18 unspecified role unspecified role neutral component neutral component 29 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:51:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 19:14:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' 22 unspecified role unspecified role neutral component neutral component physical association physical association Fig S1C. CDK4 can be seen mostly in fractions 25-28,(rather than 16-18) together with cyclin D1 (and Prmt5). Consistently, size exclusion chromatography revealed cofractionation of cyclin D1T286A, CDK4, PRMT5, MEP50, and Brg1 in murine lymphomas (Figure S1C). cycd1-prmt5-1 10 22 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P25322:p.Thr286Ala nuclear export-defective mutation mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:35:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr286ala' Tue Jun 30 17:26:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr286Ala' association association Fig 1B.