IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Dithiobis(succinimidyl propionate) (DSP) was used to stabilize the interaction. Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration. J. Biol. Chem. (0021-9258) 2007 imex curation Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx A human brain cDNA library was used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez-Negrete I., Carretero-Ortega J., Rosenfeldt H., Hernandez-Garcia R., Calderon-Salinas JV., Reyes-Cruz G., Gutkind JS., Vazquez-Prado J. Cancer - Interactions investigated in the context of cancer Source of P-REX1 and P-REX2 taken from PMID 15304342. Identification of isoforms based on PMID 15304342. (Another paper by the same group). jvazquez@cinvestav.mx Accepted 2008-DEC-10 by ORCHARD. A human brain cDNA library was used. J. Biol. Chem. (0021-9258) 2007 orchard Only protein-protein interactions imex curation prex2_human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein DEPDC2 DEP domain-containing protein 2 PREX2 protein protein human Homo sapiens Human MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLCDNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMIEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRISSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGVQLDSRKHNSHDKENKSSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDLETQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSEGIIPTDSDNEKGERNSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDSGDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKYLTPGRGLQEFQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQLRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHFQSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVYFYIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEKVKQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLVASFIRSKRTAACANTACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSVTLEQAIILARSHGLPPRYIMQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE D9E938D65CE2C7DD lst8_mouse Target of rapamycin complex subunit LST8 Mlst8 Gbl G protein beta subunit-like Lst8 Mammalian lethal with SEC13 protein 8 protein protein mouse Mus musculus Mouse MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPESSITSAHIDPDASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG DIP protein Q9DCJ1 original sequence version: 99 2F6E75383905667A rptor_human Regulatory-associated protein of mTOR p150 target of rapamycin (TOR)-scaffold protein RPTOR KIAA1303 RAPTOR protein protein human Homo sapiens Human MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWLTMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVRKELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSVSSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILSFETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYKATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALSECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR DIP protein Q8N122 original sequence version: 79 DIP protein Q8N122 original sequence version: 129 DIP protein Q8N122 original sequence version: 138 DIP protein Q8N122 original sequence version: 142 DIP protein Q8N122 original sequence version: 91 DIP protein Q8N122 original sequence version: 118 DIP protein Q8N122-1 original sequence version: 89 DIP protein Q8N122 original sequence version: 128 688ED1943F45045A prex1_human Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein PREX1 KIAA1415 protein protein human Homo sapiens Human MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGTERDYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSPMVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL DIP protein Q8TCU6 original sequence version: 150 159419355ED0F00F rictr_human Rapamycin-insensitive companion of mTOR RICTOR KIAA1999 AVO3 homolog protein protein human Homo sapiens Human MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKVLKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQERDRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKTRQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIINLCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQDSWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHISVRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFHEMKKRGPKPYSLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQHKENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQLTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYFLFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKILTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACEDKANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYVDLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQNIITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCEVLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPSTLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVSTKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDASLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAICSHSDFQDIPYSDWCEQTIHNPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLRLVINLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDVQFLQMHEEAEAVLATPPKQPIVDTSAES DIP protein Q6R327 original sequence version: 116 DIP protein Q6R327 original sequence version: 81 DIP protein Q6R327 original sequence version: 93 DB7B1E4A45DAE2AB mtor_human Serine/threonine-protein kinase mTOR MTOR FRAP FRAP2 FK506-binding protein 12-rapamycin complex-associated protein 1 Rapamycin target protein 1 FRAP1 Mammalian target of rapamycin FKBP12-rapamycin complex-associated protein Mechanistic target of rapamycin RAFT1 RAPT1 Rapamycin and FKBP12 target 1 protein protein human Homo sapiens Human MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW DIP protein P42345 original sequence version: 158 DIP protein P42345 original sequence version: 82 DIP protein P42345 original sequence version: 108 DIP protein P42345 original sequence version: 107 DIP protein P42345 original sequence version: 138 DIP protein P42345 original sequence version: 168 DIP protein P42345 original sequence version: 173 DIP protein P42345 original sequence version: 120 DIP protein P42345 original sequence version: 149 DIP protein P42345 original sequence version: 134 DIP protein P42345 original sequence version: 148 DIP protein P42345 original sequence version: 118 7D9AD6E784882AB4 q70z35-3 Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein PREX2 DEPDC2 DEP domain-containing protein 2 protein protein human Homo sapiens Human MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLCDNGFMHHVLEKSEFKDEPLLFRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQKSHSKPPGDEAGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMIEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRISSYKKVQASERFYNFTARHAVWEHSFDLHSVSSTFPVPVTMEFLLLPPPLLGISQDGRQHCIPEDLPSQEMLLAERAPV 98B38EB98ED26657 prex1-frap1 4 11 unspecified role unspecified role bait bait region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 13 unspecified role unspecified role prey prey physical association physical association 1 A We found that in yeast P-Rex1 DEP-DEP interacted with the carboxyl-terminal region, including the kinase domain, of mTOR The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. No coordinates are given for the N-terminal kinase domain of FRAP1 (mTOR) which was found to interact with P-REX1 in this assay. prex1-frap1-1 7 11 unspecified role unspecified role bait bait region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 13 unspecified role unspecified role prey prey physical association physical association 1 A, B The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. No coordinates are given for the N-terminal kinase domain of FRAP1 (mTOR) which was found to interact with P-REX1 in this assay. this interaction was specific as indicated by the growth, in restrictive media lacking adenine, histidine, leucine, and tryptophan, of yeast transformed just with the combination of P-Rex DEP-DEP and mTOR prey prex1-frap1-2 1 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 C The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. No coordinates are given for the N-terminal kinase domain of FRAP1 (mTOR) which was found to interact with P-REX1 in this assay. The carboxyl-terminal region of mTOR (mTOR prey) was detected associated with P-Rex1-DEP-DEP fused toGSTbut not withGSTused as control Q8TCU6; P42345 transfection prex1-frap1-3 3 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 D The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. Q8TCU6 transfection frap1-prex1 1 11 unspecified role unspecified role prey prey region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 E The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. No coordinates are given for the N-terminal kinase domain of FRAP1 (mTOR) which was found to interact with P-REX1 in this assay. Q8TCU6; P42345 transfection Total cell lysates were analyzed (TCL, left), and affinity-purified proteins (AP, right) showed a specific interaction of the DEP-DEP domains of P-Rex1 with GST-mTOR prey and not with the GST alone used as control. frap1-prex1-1 5 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1 F Q8TCU6; P42345 transfection A specific interaction of 3XFLAG-P-Rex1 full length with HA-mTOR prey is shown. frap1-prex1-2 2 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 1 G mTOR prey was detected associated with P-Rex1 DEP-DEP The authors do not give the coordinates of the DEP-DEP region of P-REX1; these were taken from the UniProtKB entry for the protein and thus have been entered as fuzzy coordinates. frap1-prex1-3 6 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 2 The interaction of both endogenous proteins was also assessed by immunoprecipitating mTOR, and detecting P-Rex1, frap1-prex2 1 8 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 Q70Z35-2; P42345 transfection The GST pulldown assays proved thatmTORnot only interacts with P-Rex1 but also with P-Rex2a and P-Rex2b. frap1-prex2-1 1 14 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 Q70Z35-3; P42345 transfection The GST pulldown assays proved thatmTORnot only interacts with P-Rex1 but also with P-Rex2a and P-Rex2b. frap1-prex1-4 1 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 Q8TCU6; P42345 transfection The GST pulldown assays proved thatmTORnot only interacts with P-Rex1 but also with P-Rex2a and P-Rex2b. frap1-prex1-5 1 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 Q8TCU6; P42345 transfection The GST pulldown assays proved thatmTORnot only interacts with P-Rex1 but also with P-Rex2a and P-Rex2b. frap1-prex1-6 1 11 inhibitor inhibitor unspecified role unspecified role region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region DEP-DEP region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 4 E Q8TCU6; P42345 transfection As seen in Fig. 4E, the interaction of both proteins (P-Rex1 and mTOR prey) was dramatically weakened by the expression of the DEP domains of P-Rex1, which compete with the endogenous domains of this protein. The P-REX1-mTOR interaction was dramatically weakened by the expression of the DEP domains of P-Rex1 as a competitor. frap1-prex1-7 5 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey association association 5 A Q8TCU6; Q8N122; Q9DCJ1 transfection frap1-prex1-8 5 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey association association 5 A Q8TCU6; Q6R327; Q9DCJ1 transfection