IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation. EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation. J. Biol. Chem. (0021-9258) 2006 imex curation Moeller ML., Shi Y., Reichardt LF., Ethell IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Cultures of mouse hippocampal neurons were prepared from mouse E15�16 embryos. iryna.ethell@ucr.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moeller ML., Shi Y., Reichardt LF., Ethell IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Cultures of mouse hippocampal neurons were prepared from mouse E15�16 embryos. iryna.ethell@ucr.edu Accepted 2006-AUG-25 by ORCHARD. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation. EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation. J. Biol. Chem. (0021-9258) 2006 imex curation Moeller ML., Shi Y., Reichardt LF., Ethell IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Synapse - Interactions of proteins with an established role in the presynapse. Cultures of mouse hippocampal neurons were prepared from mouse E15�16 embryos. iryna.ethell@ucr.edu 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions mouse-brain-hippocampus Mus musculus brain_hippocampus brain hippocampus fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Moeller ML., Shi Y., Reichardt LF., Ethell IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Cultures of mouse hippocampal neurons were prepared from mouse E15�16 embryos. iryna.ethell@ucr.edu Accepted 2006-AUG-25 by ORCHARD. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation fak1_mouse Focal adhesion kinase 1 Ptk2 Fadk Fak Fak1 Kiaa4203 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase p125FAK protein protein mouse Mus musculus Mouse MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH 4B7453C5D81F0F63 grb2_mouse Growth factor receptor-bound protein 2 Grb2 Adapter protein GRB2 SH2/SH3 adapter GRB2 protein protein mouse Mus musculus Mouse MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV 97F4A4FE4B248DDF src_mouse Neuronal proto-oncogene tyrosine-protein kinase Src Src pp60c-src Proto-oncogene c-Src protein protein mouse Mus musculus Mouse MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADGHRGPSAAFVPPAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL DIP protein P05480 original sequence version: 163 DIP protein P05480 original sequence version: 99 DIP protein P05480 original sequence version: 128 DIP protein P05480 original sequence version: 136 DIP protein P05480 original sequence version: 176 22CB5C6BE7A061C0 ephb2_mouse Ephrin type-B receptor 2 Tyrosine-protein kinase receptor EPH-3 Neural kinase Nuk receptor tyrosine kinase Tyrosine-protein kinase receptor SEK-3 Ephb2 Epth3 Nuk Sek3 protein protein mouse Mus musculus Mouse MAVRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDLATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIKEKLPLIVGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV DIP protein P54763 original sequence version: 151 DIP protein P54763 original sequence version: 119 DIP protein P54763 original sequence version: 123 92DB5234F18758A7 paxi_mouse Paxillin Pxn protein protein mouse Mus musculus Mouse MDDLDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVLDPLDQWQPSGSRYAHQQPPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYSFPNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHSPPGFPADEAESSPPLPGALSPLYGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKMQGLEQRVDGERPWAAGWPPSSRQSSPEGQDEGGFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC B41A1892E6F60544 ephb2-ptk2 1 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Cell lysates were subjected to immunoprecipitation against EphB2 and were probed via Western blot for FAK. FAK was found to associate with EphB2 following EphB2 activation 1 A left panel ephrinB1-Fc or ephrinB2-Fc preclustered with anti-human Fc antibody prior to application. ephb2-ptk2-1 1 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Cell lysates were subjected to immunoprecipitation against EphB2 and were probed via Western blot for FAK. FAK was found to associate with EphB2 following EphB2 activation, a finding also confirmed by FAK immunoprecipitation followed by EphB2 immunoblotting 1 A right panel ephrinB1-Fc preclustered with anti-human Fc antibody prior to application. ephb2-src 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Further reciprocal co-immunoprecipitation study identified the non-receptor tyrosine kinase Src (Fig. 1B) and the adaptor protein Grb2 (Fig. 1B, right panel) in the EphB2 immunoreactive complex following EphB activation. 1 B left panel ephrinB1-Fc preclustered with anti-human Fc antibody prior to application. ephb2-src-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Further reciprocal co-immunoprecipitation study identified the non-receptor tyrosine kinase Src (Fig. 1B) and the adaptor protein Grb2 (Fig. 1B, right panel) in the EphB2 immunoreactive complex following EphB activation. 1 B left panel ephrinB1-Fc preclustered with anti-human Fc antibody prior to application. ptk2-pxn 1 3 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Immunoprecipitations against FAK and immunoblotting against paxillin showed that FAK association with paxillin was also induced following EphB2 activation 2 C left panel ephrinB2-Fc preclustered with anti-human Fc antibody prior to application. ephb2-grb2 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Further reciprocal co-immunoprecipitation study identified the non-receptor tyrosine kinase Src (Fig. 1B) and the adaptor protein Grb2 (Fig. 1B, right panel) in the EphB2 immunoreactive complex following EphB activation. 1 D EphrinB1-Fc and ephrinB2-Fc preclustered with anti-human Fc antibody prior to application. grb2-ptk2 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Reciprocal co-immunoprecipitations identified Src and Grb2 as FAK binding partners following EphB2 activation as well 1 E EphrinB2-Fc preclustered with anti-human Fc antibody prior to application. ephb2-ptk2-2 2 3 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization The double immunolabeling also showed co-localization of EphB puncta and Tyr(P)397FAK clusters as a result of the ephrinB2-mediated activation of EphB2 3 E EphrinB2-Fc preclustered with anti-human Fc The FAK detected was phosphorylated at Tyr397. ephb2-src-2 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization the phosphorylation of Src on tyrosine 418 significantly increased (Fig. 3, D and G), specifically at the sites of EphB clustering 3 F EphrinB2-Fc preclustered with anti-human Fc antibody The Src detected was phosphorylated at Tyr418. ephb2-pxn 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization the immunolabeling of hippocampal neurons with an antibody specifically recognizing phosphorylated/activated paxillin (Tyr(P)31pax) showed a significant increase in clustering of phosphorylated paxillin at the sites of EphB clustering following treatment with ephrinB2-Fc 4 D ephrinB2-Fc preclustered with anti-human Fc antibody prior to application.