IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. J. Biol. Chem. (0021-9258) 2006 imex curation Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr Accepted 2006-JUL-18 by DAVET. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. J. Biol. Chem. (0021-9258) 2006 imex curation Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology It is assumed that GST-SPIN90 pulls down the Arp2/3 complex (Cytoskeleton Inc, Denver, CO) which consists of 7 protein subunits, all present in approximately equal stoichiometry. The protein complex used in this experiment has been purified from bovine brain. Only one protein from this complex is identifed by Western blot. wksong@gist.ac.kr Accepted 2006-JUL-18 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. Interaction of SPIN90 with the Arp2/3 complex mediates lamellipodia and actin comet tail formation. J. Biol. Chem. (0021-9258) 2006 imex curation Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr 24-JAN-2007: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Kim DJ., Kim SH., Lim CS., Choi KY., Park CS., Sung BH., Yeo MG., Chang S., Kim JK., Song WK. BioCreative - Critical Assessment of Information Extraction systems in Biology wksong@gist.ac.kr Accepted 2006-JUL-18 by DAVET. 24-JAN-2007: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation spin90_cerae_protein African green monkey SPIN90 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt spn90_human NCK-interacting protein with SH3 domain NCKIPSD AF3P21 SPIN90 54 kDa VacA-interacting protein 54 kDa vimentin-interacting protein 90 kDa SH3 protein interacting with Nck AF3p21 Dia-interacting protein 1 Diaphanous protein-interacting protein SH3 adapter protein SPIN90 WASP-interacting SH3-domain protein Wiskott-Aldrich syndrome protein-interacting protein protein protein human Homo sapiens Human MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDTLYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSASDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGHIQASVPASSPVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQRSWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLRLLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMGEAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVIMAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIFYHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRRILNEEETSPQCQMDRMIVREMCKEFLVLGEAPS 7683046B94647332 arp3_bovin Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 Actin-2 protein protein bovin Bos taurus (Bovine) Bovine MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS DIP protein P61157 original sequence version: 44 DIP protein P61157 original sequence version: 74 DIP protein P61157 original sequence version: 86 23E5564198B81C63 wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED DIP protein O00401 original sequence version: 55 DIP protein O00401 original sequence version: 147 DIP protein O00401 original sequence version: 150 DIP protein O00401 original sequence version: 136 DIP protein O00401 original sequence version: 138 DIP protein O00401 original sequence version: 125 DIP protein O00401 original sequence version: 112 DIP protein O00401 original sequence version: 126 B5895C6055E23049 arp3_cerae_protein African green monkey Arp3 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt spin90-arp3-1 1 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association COS-7 cell lysates were immunoprecipitated with anti-Arp3 antibody and immunoblotted (IB) with rabbit anti-SPIN90 antibody. 4A spin90-arp3-2 2 5 unspecified role unspecified role bait bait a-like region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association 4C & D GST pull-down assays, we confirmed that SPIN90-C-term also associates with the Arp2/3 complex wasl-arp3-1 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined vca region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range physical association physical association Positive control Exact position of VCA domain of WASL (N-WASP) not given, and have been derived for the SUPERFAMILY domain boundaries. 4D The VCA domain of N-WASP was used as a positive control for Arp2/3 complex binding. spin90-arp3-3 3 4 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization SPIN90 binds to and colocalizes with the Arp2/3 complex. 4F Platelet derived growth factor (PDGF)