DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ francez_charlot-2009-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216043X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions imex curation francez_charlot-2009-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216044X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions imex curation francez_charlot-2009-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216046X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions imex curation francez_charlot-2009-4 metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens pull down pull down western blot western blot Immuno blot Immuno blot Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. DIP original experiment: DIP-216045X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Sigma factor mimicry involved in regulation of general stress response. Francez-Charlot A., Frunzke J., Reichen C., Ebneter JZ., Gourion B., Vorholt JA. Only protein-protein interactions imex curation c5aw20_metea nepR MexAM1_META1p3109 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MWRQGDLERMNENEPAGAFPSGDRPTRGRGDNGLNDQTQRRIGSHLRTLYDSVVQQPIPDRFRDLIARLEDEPANPDDPASV phyr_metea Phyllosphere-induced regulator PhyR phyR MexAM1_META1p3110 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MSTAQLVVQHLPYLRRYARALTGSQVAGDAYVAATLETLVNEPETLGRSTNVKADLFRVFTRIWNSLSVNGHSDQVQHDLPAEVRLGQITPLPRQAFLLSCLEGFSEEDAGVILDVDVSKVRDLVDEAGRELAADMATEILIIEDEPLIAMDLEALVEGLGHNVIGVARTRTEAVKIASESKRPGLILADIQLADGSSGLDAVNDLLKTFEVPVIFITAYPERFLTGERPEPAFLIAKPFQPANVSAVISQALFFQQSARRREAHNA c5asq2_metea RNA polymerase sigma factor ecfG1 MexAM1_META1p4906 protein protein metea Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) MRNDTEATLDRPAMTDGRPKLSDSIRSHLGDHLRSVYDTLGAGEDTPSRFSELIGKLEAALKAQGERIDPEFRNGLLSAVPSLRAFALSLTSNPARSDDLVQDTLLKGWQHRARFQPGTNLNAWLFTILRNIFYSDHRKRVREVEDQDGSYAARLATAPHQGDRLDVEDLQTALAKLPPDQREALVLVGAEGVSYEEAATIMGCKVGTVKSRVSRARGRLAELLGYDEEDLSSDRLIQSAMPDA nepr-phyr-1 3184254 N/A 3184258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3184259 unspecified role unspecified role unspecified role unspecified role Q0PEV3:p.Asp190Ala D190A mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ecfg1-nepr-1 3184255 N/A 3184260 unspecified role unspecified role unspecified role unspecified role Region 65-244 Region 65-244 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3184258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nepr-1 3184256 N/A 3184258 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false nepr-ecfg1-1 3184257 N/A 3184260 unspecified role unspecified role prey prey metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens N/A 3184259 unspecified role unspecified role prey prey metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens N/A 3184258 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false metex Methylobacterium extorquens Methylobacterium dichloromethanicum Protomonas extorquens association association false false false