mpidb The Microbial Protein Interaction Database bourg-2009-1 Interactions between Brucella suis VirB8 and its homolog TraJ from the plasmid pSB102 underline the dynamic nature of type IV secretion systems. ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Bourg G., Sube R., O'Callaghan D., Patey G. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation virb8_brusu Type IV secretion system protein virB8 BRA0062 BS1330_II0062 virB8 protein protein brusu brusu MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ a0a0h3g656_brusu BS1330_II0369 protein protein brusu brusu MAGENAIEAIKPHSRGTRPRRERIEVWVSIDEKKELAERADQAGLSNAAFLRAVGLNLPIGSRADLEAVRQLAKVNGDLGRVAGLLKLWLAEKRGQGARPIDVEAMMMDFRAIQEDMRALMGKISK virb8-virb8-1 1335576 not-defined-730835995 1335577 unspecified role unspecified role bait bait periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-2085543520 1335577 unspecified role unspecified role prey prey periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 q8fws3-q8fws3 1335576 n/a 1335578 unspecified role unspecified role prey prey periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1335578 unspecified role unspecified role bait bait periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3