IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ saijo-2011-1 An ADIOL-ERβ-CtBP Transrepression Pathway Negatively Regulates Microglia-Mediated Inflammation. mouse-bv2 Mouse BV2 glioma cells bv2 Mouse microglial BV2 cells mouse, C57BL/6; Tissue: brain, microglial cells; Transformed by: retroviruses; transformed by recombinant retrovirus (v-raf/v-mic) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Saijo K., Collier J.G., Li A.C., Katzenellenbogen J.A., Glass C.K. ksaijo@ucsd.edu, ckg@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation saijo-2011-2 An ADIOL-ERβ-CtBP Transrepression Pathway Negatively Regulates Microglia-Mediated Inflammation. mouse-bv2 Mouse BV2 glioma cells bv2 Mouse microglial BV2 cells mouse, C57BL/6; Tissue: brain, microglial cells; Transformed by: retroviruses; transformed by recombinant retrovirus (v-raf/v-mic) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Saijo K., Collier J.G., Li A.C., Katzenellenbogen J.A., Glass C.K. ksaijo@ucsd.edu, ckg@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation saijo-2011-3 An ADIOL-ERβ-CtBP Transrepression Pathway Negatively Regulates Microglia-Mediated Inflammation. mouse-bv2 Mouse BV2 glioma cells bv2 Mouse microglial BV2 cells mouse, C57BL/6; Tissue: brain, microglial cells; Transformed by: retroviruses; transformed by recombinant retrovirus (v-raf/v-mic) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saijo K., Collier J.G., Li A.C., Katzenellenbogen J.A., Glass C.K. ksaijo@ucsd.edu, ckg@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fos_mouse Proto-oncogene c-Fos Fos Cellular oncogene fos protein protein mouse Mus musculus Mouse MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFTLPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYAADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL esr2_mouse Estrogen receptor beta Esr2 Estrb Nr3a2 Nuclear receptor subfamily 3 group A member 2 protein protein mouse Mus musculus Mouse MEIKNSPSSLTSPASYNCSQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGGPVRQTASPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEHTLPVNRETLKRKLGGSGCASPVTSPSAKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSASEQVHCLNKAKRTSGHTPRVKELLLNSLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTARFRELKLQHKEYLCVKAMILLNSSMYPLATASQEAESSRKLTHLLNAVTDALVWVISKSGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECCSTEDSKSKEGSQNLQSQ il23a_mouse_gene Mouse Interleukin-23 subunit alpha gene gene gene mouse Mus musculus Mouse esr2-fos 1164267 n/a 1164270 unspecified role unspecified role prey prey n/a 1164271 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6B Lipopolysaccharide esr2-il23a 1164268 n/a 1164272 unspecified role unspecified role prey prey n/a 1164271 unspecified role unspecified role bait bait association association false false false Fig. 6C esr2-fos-1 1164269 n/a 1164270 unspecified role unspecified role prey prey P01101:p.Ser362Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P01101:p.Ser362Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1164271 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6G Lipopolysaccharide