IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cao-2006-1 A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. jianminli@njmu.edu.cn Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation cao-2006-2 A testis-specific and testis developmentally regulated tumor protein D52 (TPD52)-like protein TPD52L3/hD55 interacts with TPD52 family proteins. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cao Q., Chen J., Zhu L., Liu Y., Zhou Z., Sha J., Wang S., Li J. The time required for colour development was measured for each interaction assay. Scoring scheme was ++++ colour devolpment in under 30 minutes, +++ colour development in 30 minutes to 45 minutes, ++ colour development between 45 minutes and 1 hour and + colour development between 1 and 2 hours. Directed yeast two hybrid. Figure 6 jianminli@njmu.edu.cn Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation tpd55_human Tumor protein D55 Tumor protein D52-like 3 Testis development protein NYD-SP25 TPD52L3 protein protein human Homo sapiens Human MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP tpd52_human Tumor protein D52 Protein N8 TPD52 protein protein human Homo sapiens Human MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL tpd53_human Tumor protein D53 Tumor protein D52-like 1 TPD52L1 protein protein human Homo sapiens Human MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC q68e05_human DKFZp686A1765 TPD52L2 hCG_22755 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF mal2_human Protein MAL2 MAL2 protein protein human Homo sapiens Human MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP o43399-1 Tumor protein D54 HD54+ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF o43399-2 Tumor protein D54 HD54-ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF nyd_sp25-tpd52 Yeast 2 hybrid analysis reveals interaction between Nyd-SP25 protein and TPD52 protein 366744 N/A 366746 unspecified role unspecified role bait bait N/A 366747 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. score = ++++ score = ++++ nyd_sp25-tpd53 Yeast 2 hybrid analysis reveals interaction between Nyd-SP25 protein and TPD53 protein 366744 N/A 366746 unspecified role unspecified role bait bait N/A 366748 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. score = +++ score = +++ nyd_sp25-nyd_sp25 Yeast 2 hybrid analysis reveals homotypic interaction of Nyd-SP25 protein 366744 N/A 366746 unspecified role unspecified role prey prey N/A 366746 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. score = ++ score = ++ nyd_sp25-tpd54 Yeast 2 hybrid analysis reveals interaction of Nyd-SP25 protein and TPD54 protein 366744 N/A 366749 unspecified role unspecified role prey prey N/A 366746 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. score = + score = + mal2-tpd52-1 Yeast 2 hybrid analysis reveals interaction between Mal2 protein and TPD52 protein 366744 N/A 366750 unspecified role unspecified role bait bait N/A 366747 unspecified role unspecified role prey prey physical association physical association false false false Positive control nyd_sp25-tpd54-1 GST pulldown analysis reveals interaction between the NYD-SP25 protein and the TPD54 protein 366745 N/A 366751 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 366746 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false nyd_sp25-tpd54-2 GST pulldown analysis reveals interaction between the NYD-SP25 protein and the TPD54 protein 366745 N/A 366746 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 366752 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false