MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint he-2006b-4 14-3-3sigma is a p37 AUF1-binding protein that facilitates AUF1 transport and AU-rich mRNA decay. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He C., Schneider R. Synapse - Interactions of proteins with an established role in the presynapse. This experiment relates to a negative interaction. schner01@popmail.med.nyu.edu,schner01@med.nyu.edu schner01@popmail.med.nyu.edu or schner01@med.nyu.edu EMBO J. (0261-4189) 2006 Only protein-protein interactions imex curation q14103-4 Heterogeneous nuclear ribonucleoprotein D0 p37 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY Contains a omega-N-methylarginine at position 263. Contains a N6-acetyllysine at position 273. 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN q14103-2 Heterogeneous nuclear ribonucleoprotein D0 p42 Dx4 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS q14103-1 Heterogeneous nuclear ribonucleoprotein D0 p45 Dx9 HNRNPD AUF1 HNRPD AU-rich element RNA-binding protein 1 protein protein human Homo sapiens Human MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY ywhaz-hnrpd 508349 N/A 508350 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508351 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false true 2B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation This experiment relates to a negative interaction hnrpd-ywhah 508349 N/A 508352 unspecified role unspecified role prey prey N/A 508350 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false true 1C AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation This experiment relates to a negative interaction sfn-hnrpd-4 508349 N/A 508353 unspecified role unspecified role prey prey N/A 508354 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false true 3B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. This experiment relates to a negative interaction sfn-hnrpd-5 508349 N/A 508354 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 508355 unspecified role unspecified role prey prey direct interaction direct interaction false false true 3B AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation The predominant isoform of AUF1 which bound to 14-3-3sigma was the p37 protein, and to a much lesser extent p40 AUF1. There was no detectable interaction between 14-3-3sigma and the two larger AUF1 isoforms, p42 and p45. This experiment relates to a negative interaction ywhaz-hnrpd-1 508349 N/A 508351 unspecified role unspecified role prey prey N/A 508350 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false true 1C AUF1 exists as four different isoforms (p37, p40, p42 and p45) that are generated by alternative splicing. p45 IsoformId:FQ14103-1. p42 IsoformId:FQ14103-2. Q14103-1. p40 IsoformId:FQ14103-3. p37 IsoformId:FQ14103-4.The p37 isoform of AUF1 Was used in the experiment. To date, seven 14-3-3 isoforms have been identified in human cells, all of which share a high degree of amino-acid sequence conservation This experiment relates to a negative interaction