IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mirlekar-2015-1 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease Results obtained using anti-H3 and anti SMAD2/3 antibodies have not been included due to lack of antibody specificity. Wild-type and SMAR1−/− naive CD4+ T cells from the spleen, treated with TGF-beta 1 +/- IL2, +/- stimulation by anti-CD3/28. samit@nccs.res.in Mucosal immunology 2015 imex curation Only protein-protein interactions imex curation mirlekar-2015-2 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S., Mirlekar B., Ghorai S., Khetmalas M., Bopanna R., Chattopadhyay S. IBD - Inflammatory bowel disease Results obtained using anti-H3 antibodies have not been included due to lack of antibody specificity. CD4+CD25+ Treg and CD4+CD25− T cells from the spleen, treated with TGF-beta1 and IL-2, with anti-CD3/28. samit@nccs.res.in Mucosal immunology 2015 imex curation Only protein-protein interactions imex curation foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM stat3_mouse_gene Signal transducer and activator of transcription 3 Stat3 Aprf gene gene mouse Mus musculus Mouse banp_mouse Protein BANP Btg3-associated nuclear protein Scaffold/matrix-associated region-1-binding protein Banp Smar1 protein protein mouse Mus musculus Mouse MMSEQDLADVVQIAVEDLSPDHPVVLENHVVTDDDEPALKRQRLEINCQDPSIKSFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTVILNNDRQNAIVAKMEDPLSNRAPDSLENIISNAVPGRRQNTIVVKVPGQDDSHNEDGESGSEASDSVSNCGQPGSQNIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPSSSSYSASETMMGTPPPTSELQQSQPQALHYALANAQQVQIHQIGEDGQVQVIPQGHLHIAQVPQGEQVQITQDSEGNLQIHHVGQDGQSWGLCQNPIPVSGDSVAQANPSQLWPLGGDTLDLPAGNEMIQVLQGAQLIAVASSDPAATGVDGSPLQGSDIQVQYVQLAPVSDHTAAAQTAEALQPTLQPDMQLEHGAIQIQ hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA stat3-foxp3-2 1876417 N/A 1876419 unspecified role unspecified role prey prey promoter_region_(cns2) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876420 unspecified role unspecified role bait bait tyr705 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain false association association false false false 8C P08505 increases the binding of P42227 to ENSMUSG00000039521 It is stated earlier in this publication that:- "STAT3......binds to the CNS2 region (silencer site) of Foxp3 promoter and represses its transcription", thus it has been assumed primers for the CNS2 site have been used here; the CNS2 site is usually referred to as an "enhancer", located in intron-1, not as part of the (upstream) promoter. Is is stated that:- "cells treated with TGF-beta-1 ..... resulted in less binding of STAT3 to the Foxp3 promoter in WT CD4+ T cells (Figure 8c)";however no results are shown for cells not treated with TGF-beta-1 to verify this statement. Q8VBU8 decreases the binding of P42227 to ENSMUSG00000039521 Q8VBU8 increases the expression at protein level of ENSMUSG00000039521 Q8VBU8 increases the expression at RNA level of ENSMUSG00000039521 banp-stat3-1 1876417 N/A 1876421 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876422 unspecified role unspecified role bait bait association association false false false 8 D/F P04351 and P04202 increased the binding of Q8VBU8 to ENSMUSG00000004040 Q8VBU8 increases the expression at RNA level of ENSMUSG00000004040 Q8VBU8 increases the expression at protein level of ENSMUSG00000004040 IL-2 (P04351) TGF-beta1 (P042020) hdac1-stat3-1 1876417 N/A 1876421 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876423 unspecified role unspecified role bait bait association association false false false 8 D/F P04351 and P04202 increased the binding of O09106 to ENSMUSG00000004040 TGF-beta1 (P042020) IL-2 (P04351) banp-stat3-2 1876418 N/A 1876421 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876422 unspecified role unspecified role bait bait association association false false false 8 G Binding of SMAR1 to the STAT3 promoter in CD4+CD25+ Treg cells is greater than in CD4+CD25− T cells. P04351 increases the expression at protein level of Q8VBU8 hdac1-stat3-2 1876418 N/A 1876421 unspecified role unspecified role prey prey il6re_promimal_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876423 unspecified role unspecified role bait bait association association false false false 8 Gi Binding of HDAC1 to the STAT3 promoter in CD4+CD25+ Treg cells is greater than in CD4+CD25− T cells.