IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Evolution of enhanced innate immune evasion by SARS-CoV-2. Evolution of enhanced innate immune evasion by SARS-CoV-2. Nature 2021 imex curation Thorne LG., Bouhaddou M., Reuschl AK., Zuliani-Alvarez L., Polacco B., Pelin A., Batra J., Whelan MVX., Hosmillo M., Fossati A., Ragazzini R., Jungreis I., Ummadi M., Rojc A., Turner J., Bischof ML., Obernier K., Braberg H., Soucheray M., Richards A., Chen KH., Harjai B., Memon D., Hiatt J., Rosales R., McGovern BL., Jahun A., Fabius JM., White K., Goodfellow IG., Takeuchi Y., Bonfanti P., Shokat K., Jura N., Verba K., Noursadeghi M., Beltrao P., Kellis M., Swaney DL., García-Sastre A., Jolly C., Towers GJ., Krogan NJ. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins email sent 3/1/22. NO REPLY 17/2/22: - TOM70 human? + full length? Flag tag N/C terminal? Strep tag on ORf9B C terminal? c.jolly@ucl.ac.uk, g.towers@ucl.ac.uk, nevan.krogan@ucsf.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thorne LG., Bouhaddou M., Reuschl AK., Zuliani-Alvarez L., Polacco B., Pelin A., Batra J., Whelan MVX., Hosmillo M., Fossati A., Ragazzini R., Jungreis I., Ummadi M., Rojc A., Turner J., Bischof ML., Obernier K., Braberg H., Soucheray M., Richards A., Chen KH., Harjai B., Memon D., Hiatt J., Rosales R., McGovern BL., Jahun A., Fabius JM., White K., Goodfellow IG., Takeuchi Y., Bonfanti P., Shokat K., Jura N., Verba K., Noursadeghi M., Beltrao P., Kellis M., Swaney DL., García-Sastre A., Jolly C., Towers GJ., Krogan NJ. Coronavirus - Interactions investigated in the context of Coronavirus email sent 3/1/22. NO REPLY 17/2/22: - TOM70 human? + full length? Flag tag N/C terminal? Strep tag on ORf9B C terminal? TOM 70 determined to be of Human origin, as used in PDBe entry:7kdt, in pmid:33060197;-previous work by last author. c.jolly@ucl.ac.uk, g.towers@ucl.ac.uk, nevan.krogan@ucsf.edu Accepted 2022-JAN-24 AT 08:14 GMT AT 08:14 GMT by ORCHARD Nature 2021 Only protein-protein interactions imex curation imex curation tom70_human Mitochondrial import receptor subunit TOM70 TOMM70 KIAA0719 TOM70 TOMM70A Translocase of outer membrane 70 kDa subunit Translocase of outer mitochondrial membrane protein 70 Mitochondrial precursor proteins import receptor protein protein human Homo sapiens Human MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL 5AAF5CAAA8582480 orf9b_sars2 ORF9b protein Accessory protein 9b ORF-9b Protein 9b 9b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK orf9b_sars2-tomm70-25 1 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTD2:p.Ser50Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Thu Jan 06 20:05:01 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser50Ala' P0DTD2:p.[Ser50Ala;Ser53Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Thu Jan 06 18:45:42 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser50Ala;Ser53Ala]' P0DTD2:p.Ser53Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Thu Jan 06 20:04:13 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Ala' P0DTD2:p.Ser50Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S E Thu Jan 06 19:15:33 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser50Glu' P0DTD2:p.Ser53Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S E Thu Jan 06 18:25:46 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Glu' P0DTD2:p.[Ser50Glu;Ser53Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain S E Thu Jan 06 20:13:30 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser50Glu;Ser53Glu]' physical association physical association 4D, Extended Data 9.