IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. ACS chemical neuroscience 2021 imex curation Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Accepted 2022-JAN-11 AT 13:39 GMT AT 13:39 GMT by LUANA ACS chemical neuroscience 2021 Only protein-protein interactions imex curation imex curation Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. ACS chemical neuroscience 2021 imex curation Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Only protein-protein interactions imex curation in vitro In vitro fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Accepted 2022-JAN-11 AT 13:39 GMT AT 13:39 GMT by LUANA ACS chemical neuroscience 2021 Only protein-protein interactions imex curation imex curation Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. ACS chemical neuroscience 2021 imex curation Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Only protein-protein interactions imex curation in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Accepted 2022-JAN-11 AT 13:39 GMT AT 13:39 GMT by LUANA ACS chemical neuroscience 2021 Only protein-protein interactions imex curation imex curation Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. ACS chemical neuroscience 2021 imex curation Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Only protein-protein interactions imex curation in vitro In vitro aggregation aggregation assay aggregation predetermined predetermined participant predetermined Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins cannot follow up purification as refs trace back to a 2009 pHD thesis. The aggregation process is followed by recording the fluorescence of the amyloid-binding dye ThT;the fluorescence of the dye ThT increases upon binding to amyloid fibrils. c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Accepted 2022-JAN-11 AT 13:39 GMT AT 13:39 GMT by LUANA ACS chemical neuroscience 2021 Only protein-protein interactions imex curation imex curation Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation. ACS chemical neuroscience 2021 imex curation Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Semerdzhiev SA., Fakhree MAA., Segers-Nolten I., Blum C., Claessens MMAE. Virus - Publications including interactions involving viral proteins I was going to enter as a 'colocalisation' until I looked at the Manual. plus I have no idea if it is possible to show fluorescence donor/acceptor roles here. A FRET Probe is labelled with Alexa 488 (donor) and Alexa 568(acceptor) at mutated residues -either Cys 9 or Cys 69. Purification ensured that the final sample only contained both the AF488 and AF568 FRET labeled alpha-S and some alpha-S with two AF568. Membrane-bound alpha-syn assumes an alpha-helical conformation. In the antiparallel alpha-helical form of alpha-syn residues 6 and 69 are very close and thus show high FRET, while in the unstructured form the average distance between the residues is larger, resulting in lower FRET; thus low FRET values indicate cytosolic localisation, high FRET - vesicle bound. The observed FRET is a result of a specific protein conformation rather than a signature of inter -alphaSyn interactions. c.blum@utwente.nl,m.m.a.e.claessens@utwente.nl Accepted 2022-JAN-11 AT 13:39 GMT AT 13:39 GMT by LUANA ACS chemical neuroscience 2021 Only protein-protein interactions imex curation imex curation ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 snca-snca-30 4 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 1, 3 In the absence of additional proteins the onset of aggregation of alpha-S is observed at time scales >240 h. In the presence of the N protein aggregation time was reduced to <24 h. In the presence of N-protein, aggregation of alpha-S proceeds in two steps, represented by two plateaus in the observed ThT fluorescence. P0DTC9 - N protein increasing NaCl concentration. n-snca-1 1 6 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified cys140 alexa 488 label alexa 488 label certain certain sequence position certain certain certain sequence position certain A C P37840:p.Ala140Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 18:26:57 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Cys' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A A] N protein is either produced with N-terminal His tag (from Elabscience) or "for additional control experiments" "in our laboratory" (ref. 52) where the His-tag +MBP tag (?-?) were removed. I assume the commercial variant was used here. The lines indicate binding with a Hill coefficient of 1 (orange) and 4 (blue) indicating binding is cooperative. snca-snca-32 2 7 unspecified role unspecified role neutral component neutral component purified purified cys140 alexa label alexa label certain certain sequence position certain certain certain sequence position certain A C P37840:p.Ala140Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 18:36:47 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Cys' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified cys140 alexa label alexa label certain certain sequence position certain certain certain sequence position certain A C P37840:p.Ala140Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 19:55:32 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Cys' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 B-D n-snca-2 2 7 unspecified role unspecified role neutral component neutral component purified purified cys140 alexa label alexa label certain certain sequence position certain certain certain sequence position certain A C P37840:p.Ala140Cys mutation mutation certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 18:57:21 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala140Cys' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 B On average, 3 to 4 alpha-S proteins are present in an alpha-S/N-protein complex. snca-snca-31 3 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3 Two distinctly different fibril populations, with different morphologies, can be discriminated. The N-protein speeds up the formation of alpha-S fibrils but does not change the morphology of fibrils observed after long time incubation. snca-snca-33 5 7 unspecified role unspecified role putative self putative self purified purified cys9 or cys69 alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P37840:p.[Ser9Cys;Ala69Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain S C certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 20:24:16 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser9Cys;Ala69Cys]' cys9 or cys69 alexa 568 label alexa 568 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role putative self putative self purified purified cys9 or cys69 alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P37840:p.[Ser9Cys;Ala69Cys] mutation mutation certain certain sequence position certain certain certain sequence position certain S C certain certain sequence position certain certain certain sequence position certain A C Thu Jan 06 18:56:12 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser9Cys;Ala69Cys]' cys9 or cys69 alexa 568 label alexa 568 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) proximity proximity close-contact colocalization neighbourhood interaction 4 In the cells that were microinjected with N-protein, less high FRET (orange) signal was seen compared to the control group, which indicates there is less vesicle-bound alpha-Syn in N-treated cells.