IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation mouse-dbt mouse astrocytoma cell line dbt dbt mouse astrocytoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins DBT-ACE2 (mouse astrocytoma cell line) cells stably expressing the murine ACE2 receptor. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins no This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-calu_3 Homo sapiens lung adenocarcinoma calu_3 male caucasian lung adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Bronchial epithelial cell line Calu-3 2B4; Calu-3 cells stably expressing ACE2. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins RNA-IP; No cross linking was carried out prior to IP. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. MOV10 Helicase Interacts with Coronavirus Nucleocapsid Protein and Has Antiviral Activity. mBio 2021 imex curation Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es Accepted 2021-SEP-27 AT 16:39 BST AT 16:39 BST by ORCHARD mBio 2021 Only protein-protein interactions imex curation imex curation k0bvn3_mers Nucleoprotein N Nucleocapsid protein protein protein cv2ce Human betacoronavirus 2c EMC/2012 MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWYTGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYYTGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNFHIEGTGGNSQSSSRASSLSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDLLNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQGNFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGAIKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSITQRTRTRPSVQPGPMIDVNTD 2313611CDFDD4497 g-rna human betacoronavirus 2c emc/2012 rna ribonucleic acid RNA rna cv2ce Human betacoronavirus 2c EMC/2012 ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA DIP protein Q9UKV8 original sequence version: 1(def) DIP protein Q9UKV8 original sequence version: 44 DIP protein Q9UKV8 original sequence version: 60 DIP protein Q9UKV8 original sequence version: 62 DIP protein Q9UKV8 original sequence version: 89 DIP protein Q9UKV8 original sequence version: 85 DIP protein Q9UKV8 original sequence version: 87 DIP protein Q9UKV8 original sequence version: 99 DIP protein Q9UKV8 original sequence version: 117 DIP protein Q9UKV8-1 original sequence version: 117 DIP protein Q9UKV8 original sequence version: 145 DIP protein Q9UKV8 original sequence version: 108 5C8552C43FC81345 ncap_cvh22 Nucleoprotein N Nucleocapsid protein 7 protein protein hcov-229e Human coronavirus 229E HCoV-229E MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN mint homomint D3D86CFE10EEDCA1 mov10_mouse Putative helicase MOV-10 Mov10 Gb110 Moloney leukemia virus 10 protein protein protein mouse Mus musculus Mouse MPSKFSCRKLRETGQRFESFLAERGLDLETDRERLRTIYNHDFKPSYGTPAPGFSSMLYGMKIANLAFVTKTRVRFFKLDRWADVQLPEKRRIKPGSNISKQHRSLLARIFHDRAEYLHGKHGVDVEVQGPHEARDGQLLIHLDLNRKEVLTLRLRNGGSKPVTLTHLFPLCWTPQFVFYHGEQDLPCPLGPGESYELHIYCKTSIVGYFPATVLWELLGPGESGAEGAETFYIARFLAAVAHSPLAAQLKPTTPFKRPPRLTRNSVLTNRIEEGERPDRAKGYELELSLALGTYYPPILLRQLLPTLLQGPSIFTAPKEVAEIKAQLETTLKSRNYEVKLRLLLHLEELQMEHDIRHYDLDSVPMTWDPVDQNPRLLTLEVPGVAESRPSVLRGDHLFALLSSETQQDDPVTYKGFVHKVELDRVKLSFSTSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWVLWPMLFPVASRGVSLLPSDVKFKLYDRSLESNPEQLQAMKHIVRGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKTCCNWDAKKGEYVYPAKKHLQQYRVLITTLITASRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLRSPLALKHGLGYSLLERLLAYNSLYKKGPNGYDPQFITKLLRNYRSHPTILDIPNQLYYDGELQACADVVDRERFCRWEGLPQQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKQLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLLGHDPDWKTFLEFCKENGGYTGCPFPAKLDLQQGQDLLQGLSKLSPSTSGPRRHQNLPQEREGEGGLPLQVEPEWRNEL DIP protein P23249 original sequence version: 79 mint May be an helicase with an important function in development and/or control of cell proliferation 8B2522AAB35B6F2B ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA ncap_sars Nucleoprotein N 9a Nucleocapsid protein protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA mint Major structural component of virions that associates with genomic RNA to form a long, flexible, helical nucleocapsid 43FC8750F1253034 mov10_human Helicase MOV-10 Moloney leukemia virus 10 protein MOV10 KIAA1631 Armitage homolog protein protein human Homo sapiens Human MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRAKGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNEL DIP protein Q9HCE1 original sequence version: 55 DIP protein Q9HCE1 original sequence version: 74 28A8B3BF9B5B54FC rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY DIP protein Q92900 original sequence version: 137 DIP protein Q92900 original sequence version: 76 DIP protein Q92900 original sequence version: 101 DIP protein Q92900 original sequence version: 102 DIP protein Q92900 original sequence version: 135 DIP protein Q92900-1 original sequence version: 123 DIP protein Q92900 original sequence version: 132 6CCA6FE42B15BA28 tiar_human Nucleolysin TIAR TIAL1 TIA-1-related protein protein protein human Homo sapiens Human MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ 2F8D1C7169A7817E mov10-n-1 4 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 18:39:16 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' colocalization colocalization 1A MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-n-2 2 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Q9HCE1:p.[Lys530Ala;Asp645Asn] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain D N Tue Oct 05 18:40:19 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys530Ala;Asp645Asn]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 19:07:12 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' physical association physical association 2 A/B, 7D RNAse The interaction of N protein with MOV10 was RNA dependant. "no - uniprot export" added at experiment level. 'Suff to bind' region found from translation of "a DNA fragment containing nucleotides 1724 to 3066 of MOV10 gene" for HEL mutant. tial1-mov10-2 7 17 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 19:33:08 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' association association 2D tial1-mov10-1 7 17 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2D Weak interaction. The text states:-"Endogenous MOV10 protein interaction in mock-infected cells was detected only for TIAR." ago2-mov10-1 7 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 18:38:37 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' association association 2D upf1-mov10-1 7 16 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 19:26:47 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' association association 2D mov10-n-3 6 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 18:42:52 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' colocalization colocalization Supp. figure 1 MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-to set_4-1 5 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N protein mRNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 5 ago2-mov10-2 7 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain N K Tue Oct 05 19:04:17 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn30Lys' association association 6D This interaction was seen in MOV10-KO cells. despite what the text states I have not entered any comment for figure 6D IPs for Baits TIAR and UPF1 in KO cells, as they appear to detect the N protein in the "mock" blot - and the "infected" blot intensity is no greater than the "mock" one by any stretch of imagination. imho. mov10-n-4 1 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey infection infection physical association physical association 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. "no - uniprot export" added at experiment level. -Not shown to be RNA dependant, but probable? mov10-n-5 3 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey infection infection physical association physical association 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. "no - uniprot export" added at experiment level. -Not shown to be RNA dependant, but probable? mov10-n-6 2 11 unspecified role unspecified role prey prey infection infection 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. "no - uniprot export" added at experiment level. -Not shown to be RNA dependant, but probable?