IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". Some cells were pre-treated with LPS and Nigericin (an antibiotic and bacterial toxin) to generate inflammasome activation and induce pyroptosis. xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". Caspase 1 - species origin is Human, based on mutation mapping. xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". Some cells were pre-treated with LPS and Nigericin (an antibiotic and bacterial toxin) to generate inflammasome activation and induce pyroptosis. xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". Caspase 1 - species origin is Human, based on mutation mapping. xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. SARS-CoV-2 nucleocapsid suppresses host pyroptosis by blocking Gasdermin D cleavage. The EMBO journal 2021 imex curation Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Ma J., Zhu F., Zhao M., Shao F., Yu D., Ma J., Zhang X., Li W., Qian Y., Zhang Y., Jiang D., Wang S., Xia P. Virus - Publications including interactions involving viral proteins GSDMD expressed in HEK293T cells; the only purification details i can see for the "purified" protein is that it was "purified by IP (FLAG)" so have entered all interactions for this protein as "partially purified". xiap@pku.edu.cn,wangshuo@im.ac.cn Accepted 2021-OCT-15 AT 10:38 BST AT 10:38 BST by KALPANAP The EMBO journal 2021 Only protein-protein interactions imex curation imex curation gsdmd_mouse Gasdermin-D Gsdmd Gasdermin domain-containing protein 1 Gsdmdc1 protein protein mouse Mus musculus Mouse MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTEVLQTKEEVQITEVHSQEGSGQFTLPGALCLKGEGKGHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC DIP protein Q9D8T2 original sequence version: 85 ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA gsdmd_human Gasdermin-D DFNA5L GSDMDC1 Gasdermin domain-containing protein 1 FKSG10 GSDMD protein protein human Homo sapiens Human MGSAFERVVRRVVQELDHGGEFIPVTSLQSSTGFQPYCLVVRKPSSSWFWKPRYKCVNLSIKDILEPDAAEPDVQRGRSFHFYDAMDGQIQGSVELAAPGQAKIAGGAAVSDSSSTSMNVYSLSVDPNTWQTLLHERHLRQPEHKVLQQLRSRGDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKELELLDRELCQLLLEGLEGVLRDQLALRALEEALEQGQSLGPVEPLDGPAGAVLECLVLSSGMLVPELAIPVVYLLGALTMLSETQHKLLAEALESQTLLGPLELVGSLLEQSAPWQERSTMSLPPGLLGNSWGEGAPAWVLLDECGLELGEDTPHVCWEPQAQGRMCALYASLALLSGLSQEPH DIP protein P57764 original sequence version: 113 F7CE8073E0C0194D casp1_human Caspase-1 Interleukin-1 beta convertase Interleukin-1 beta-converting enzyme p45 CASP1 IL1BC IL1BCE protein protein human Homo sapiens Human MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH DIP protein P29466 original sequence version: 155 DIP protein P29466-1 original sequence version: 169 DIP protein P29466 original sequence version: 169 DIP protein P29466 original sequence version: 163 DIP protein P29466 original sequence version: 101 DIP protein P29466 original sequence version: 160 DIP protein P29466 original sequence version: 184 ABF33CF33CC71584 n-gsdmd-1 6 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A, Supp. figure 3C gsdmd-n-1 4 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 3B gsdmd-n-2 10 13 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3C gsdmd-n-3 1 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component partially purified partially purified colocalization colocalization 3D, Supp. figure 3E gsdmd-n-4 3 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3E LPS and Nigericin (CHEBI:7569) n-gsdmd-2 7 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3F LPS and Nigericin (CHEBI:7569) n-gsdmd-3 2 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 3H All seven nucleocapsid fragments interacted with the GSDMD C-terminus. Fragments containing amino acids 70-160 and 290-360 had the highest binding affinity for GSDMD. gsdmd-n-5 5 13 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 3I Nucleocapsid lacking amino acids 70-160 and 290-360 had a slightly weaker association with GSDMD than full-length nucleocapsid. casp1-gsdmd-1 9 14 enzyme enzyme neutral component neutral component purified purified p20/p10 regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 enzyme target enzyme target substrate substrate neutral component neutral component partially purified partially purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 4G casp1-gsdmd-2 9 12 inhibitor inhibitor neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 enzyme enzyme neutral component neutral component purified purified p20/p10 regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 enzyme target enzyme target substrate substrate neutral component neutral component partially purified partially purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) protein cleavage protein cleavage 4G, (5 G/H) Full-length GSDMD, expressed from 293T cells, with a substituted or chimeric linker was cleaved normally by the p20/p10 complex even in the presence of Nucleocapsid. I have not entered figs 5 G/H as we do not do chimeras, and the "substituted" one counts as a chimera as well, as far as I am concerned. For WT GSDMD from 293T cells, if this has been only IP purified the interaction cannot be entered as not "direct". gsdmd-n-6 5 14 unspecified role unspecified role prey prey purified purified p20/p10 regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P29466:p.Cys285Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association 5A gsdmd-casp1-1 5 14 unspecified role unspecified role prey prey purified purified P29466:p.Cys285Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A p20/p10 regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range regions required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 5A, Supp. 5B GSDMD truncation without both aas 302-310 and aas 350-368 completely lost its capacity to bind the p20/p10 complex. Deletion of one of these regions substantially reduced binding. gsdmd-n-7 5 13 unspecified role unspecified role bait bait partially purified partially purified regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5 C/D, Supp. figure 3D,5D, 5G GSDMD without the linker region (aas 265-284) or when it was replaced by chimeric GSDMD, bound slightly less nucleocapsid than intact GSDMD. gsdmd-n-8 10 13 unspecified role unspecified role bait bait partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range linker region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 5E n-gsdmd-4 6 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5I, Supp. 5 C/E/F The association between GSDMD or chimeric GSDMD and nucleocapsid was slightly diminished when the linker region was replaced. we do not do chimeras, and the "substituted" one counts as a chimera as well GSDMD truncations lacking the p20/p10 interacting regions were still able to interact with nucleocapsid. n-gsdmd-5 6 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. figure 3B tgqwergagre-1 8 12 unspecified role unspecified role prey prey infection infection 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. figure 3F