IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus NO method for EMSA that I can find; thus Tag visualisation for detection. (although probably weight-autoradiography) oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus SEC-MALS (Size Exclusion Chromatography with MultiAngle Light Scattering). oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation in vitro In vitro sans small angle neutron scattering SANS SANS sans predetermined predetermined participant predetermined Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation in vitro In vitro rna rna pol assay rna directed rna polymerase assay rna rna pol assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Transient complexes of the Nsp7, Nsp8 and Nsp12 in SARS-CoV-2 replication transcription complex. Biophysical journal 2021 imex curation Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Only protein-protein interactions imex curation in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Wilamowski M., Hammel M., Leite W., Zhang Q., Kim Y., Weiss K., Jedrzejczak R., Rosenberg DJ., Fan Y., Wower J., Bierma J., Sarker AH., Tsutakawa SE., Pingali SV., O'Neill HM., Joachimiak A., Hura GL. Coronavirus - Interactions investigated in the context of Coronavirus oneillhm@ornl.gov, andrzejj@anl.gov, glhura@lbl.gov Accepted 2021-NOV-10 AT 15:48 GMT AT 15:48 GMT by SIMONA Biophysical journal 2021 Only protein-protein interactions imex curation imex curation p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 short_ssrna oligo rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) CAUGCUACGCGUAGCAUGCUACGCGUAG 31mer_hairpin_rna rna ribonucleic acid RNA rna in vitro In vitro GGCUUAGGAGAUGAUGAAAGUCAUUCUCCU residues 9-23 map to MW365029.1 (SARS-CoV-2/human/CHL/Santiago-PUC_MVL_0400/2020) long_ssrna oligo rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) UUUUCAUGCUACGCGUAGCAUGCUACGCGUAGCAUG rep-rep-210 4 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Table S1 Crystals of Nsp7/8A (PDB: 6WIQ) were shown to have a truncated N-terminus (at residue Glu78) for Nsp8. For entries B/C (6WQD and 6XIP) NSP8 also starts at Asp78 because of the truncation by protease V8/Glu-C. rep-rep-211 6 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4B,2, table S2 rep-rep-212 2 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A,2, 4A bottom, 5A bottom, supp. figure 2, table S2 Nsp7 forms multimers and dimers. rep-213 2 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A,2, Supp. figure 2, table S2 Nsp7 forms multimers and dimers. rep-rep-213 2 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A,2, table S2 Nsp8 forms concentration-dependent oligomers in solution. text does not specifically say that a dimer forms, but Figure 2 + Table S2 M.Wt data does. rep-214 6 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B,2, Supp. figure 2B, table S2 Best-fit model for Nsp7 is an alternate dimer. rep-215 6 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B,2, Supp. figure 4, table S2 A mixture of the dimer and monomer models fitted the SAXS data for Nsp8 at a 2.5 mg/mL concentration and the SAXS data from the leading edge of the SEC major elution peak. rep-rep-214 3 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified region 2h label 2h label deuterium D2 2H2 2H2 deuterium D2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2, 3F, 4G, Table S2 Nsp7 dramatically modifies Nsp8 conformation or assembly. rep-216 2 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A,2, 4A, table S2 Nsp8 forms concentration-dependent oligomers in solution. Figure 3A: In this figure Nsp8 appears to form one peak with an M.Wt of ~110 kDa. (calculated M. Wt of monomer is ~22kDa) Figure 4A also shows one peak for Nsp8, but as there are no values given for M.Wt values on the upper part of the X-axis, is it not possible to estimate the M.wt of this peak. rep-rep-215 2 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A, bottom,Table S2 I have ignored the second small peak for Nsp7+8 that figure 2 says is present -as too small. No Stoich. values entered as you cannot tell from figure 4A and Figure 2 = ?? A transient complex composed of oligomers and free proteins. long_ssrna oligo-short_ssrna-1 6 10 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 45 43 direct interaction direct interaction 4 B/C, 2, Table S2 long_ssrna oligo-rep-1 2 12 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4A top, 2, Supp. figure 5,Table S2 Neither Figure 2 or 4 (Supp. figure 5) indicate which form of ssRNA was used, but the text states:- "Nsp8 did bind the long ssRNA, but not the short ssRNA, at high affinity. The mixture of Nsp8 with long ssRNA shows only one distinct peak, consistent with the 1:1 complex." long_ssrna oligo-rep-2 2 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 54 56 direct interaction direct interaction 4A bottom, 2 These experiments do not support a stable ternary Nsp7/8 dsRNA complex. rep-short_ssrna oligo-1 1 10 unspecified role unspecified role bait bait region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4D long_ssrna oligo-rep-4 1 12 unspecified role unspecified role neutral component neutral component region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4D rep-rep-216 3 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 2, Table S2 M. Wt for Nsp8 is given as 38 kDa for SANS in table S2. (Monomer =24kDa) there is no entry for dsRNA + Nsp7/8 in table S2 for SANS, so have made no entry here (text unclear) rep-rep-217 2 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A top, table S2 There is no Nsp8/12 interaction with RNA. long_ssrna oligo-rep-3 2 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 78 76 direct interaction direct interaction 5A bottom, 2, Table S2 The addition of dsRNA or ssRNA stabilizes the Nsp7/8/12/RNA within a 1:2:1:1 complex;unfortunately the identity of the ssRNA is not stated. long_ssrna oligo-rep-5 6 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 84 86 direct interaction direct interaction 5B, 2, Table S2 The addition of dsRNA or ssRNA stabilizes the Nsp7/8/12/RNA within a 1:2:1:1 complex;unfortunately the identity of the ssRNA is not stated. rep-rep-218 6 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 5B, table S2 31mer_hairpin_rna-rep-1 5 9 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate neutral component neutral component region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 1 EDTA;CHEBI:42191 The RTC creating duplexed 36 basepaired RNA from a 31 base hairpin substrate. long_ssrna oligo-rep-6 2 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 3 long_ssrna oligo-short_ssrna oligo-1 6 12 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 3, figure 2. long_ssrna oligo-rep-7 2 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 5A bottom, 2, Supp. figure 7, Table S2 A heterogeneous and weak Nsp7/8/12 complex. Nsp7/8/12 does not form a stable structure until RNA is present. The first SEC trace, shows a split peak and tail with a significant peak from Nsp7 at later elution times, already suggesting transient dissociation of Nsp7 from the Nsp8/12 complex. not sure if this structure exists - Supp figure 7 suggests it does, but figure 5A bottom suggests Nsp7 dimer splits off, and Fig 2 only lists Nsp7/8/12 as consisting of 8+ 12 and Nsp7 dimer.