DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Inhibitors of bacterial H₂S biogenesis targeting antibiotic resistance and tolerance. Inhibitors of bacterial H₂S biogenesis targeting antibiotic resistance and tolerance. Science (New York, N.Y.) 2021 imex curation Shatalin K., Nuthanakanti A., Kaushik A., Shishov D., Peselis A., Shamovsky I., Pani B., Lechpammer M., Vasilyev N., Shatalina E., Rebatchouk D., Mironov A., Fedichev P., Serganov A., Nudler E. evgeny.nudler@nyulangone.org Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Shatalin K., Nuthanakanti A., Kaushik A., Shishov D., Peselis A., Shamovsky I., Pani B., Lechpammer M., Vasilyev N., Shatalina E., Rebatchouk D., Mironov A., Fedichev P., Serganov A., Nudler E. evgeny.nudler@nyulangone.org Accepted 2021-NOV-02 AT 07:12 GMT AT 07:12 GMT by ORCHARD Science (New York, N.Y.) 2021 imex curation Inhibitors of bacterial H₂S biogenesis targeting antibiotic resistance and tolerance. Inhibitors of bacterial H₂S biogenesis targeting antibiotic resistance and tolerance. Science (New York, N.Y.) 2021 imex curation Shatalin K., Nuthanakanti A., Kaushik A., Shishov D., Peselis A., Shamovsky I., Pani B., Lechpammer M., Vasilyev N., Shatalina E., Rebatchouk D., Mironov A., Fedichev P., Serganov A., Nudler E. evgeny.nudler@nyulangone.org Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Shatalin K., Nuthanakanti A., Kaushik A., Shishov D., Peselis A., Shamovsky I., Pani B., Lechpammer M., Vasilyev N., Shatalina E., Rebatchouk D., Mironov A., Fedichev P., Serganov A., Nudler E. evgeny.nudler@nyulangone.org Accepted 2021-NOV-02 AT 07:12 GMT AT 07:12 GMT by ORCHARD Science (New York, N.Y.) 2021 imex curation x5e0f1_staau mccB mccB_2 DD547_00421 EP54_01605 EQ90_13355 FA040_13395 GO814_02345 GZ145_06650 HMPREF3211_01439 NCTC10654_00533 NCTC10702_00840 SAMEA2078588_01369 BTN44_10510 DQU54_02430 ELP52_13565 GO942_04060 GQX37_00125 RK64_02780 SAGV51_00538 SAGV69_02191 SAHC1335_01297 SAMEA1029536_02405 SAMEA103891420_01931 SAMEA2076468_01131 SAMEA2076503_02354 SAMEA2077334_02557 SAMEA2078260_02460 SAMEA2079501_02499 SAMEA2080344_01429 SAMEA2081063_02563 SAMEA4008569_02655 SAMEA70146418_02721 protein protein staau Staphylococcus aureus MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPTRSSVESVIATLENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRALTKVFTRFGIEVDFVDTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL 21540C56812D5959 q9i6a0_pseae PA0400 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSQHDQHPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQESPGVHKGLDYGRSHNPTRWALERCVADLEGGTQAFAFASGLAAISSVLELLDAGSHIVSGNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLQAFEAALTPETRMVWVETPSNPLLRLTDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLNGHSDVIGGIAIVGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRMERHCSNALALAQWLERQPQVARVYYPGLASHPQHELAKRQMRGFGGMISLDLRCDLAGARRFLENVRIFSLAESLGGVESLIEHPAIMTHASIPAETRADLGIGDSLIRLSVGVEALEDLQADLAQALAKI E8F4BAC6F4BB607F p32929-1 Cystathionine gamma-lyase Cysteine-protein sulfhydrase Gamma-cystathionase CTH protein protein human Homo sapiens Human MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS 003246D7C1D16723 mccb-2 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified X5E0F1:p.Tyr103Asn X5E0F1:p.Tyr103Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y N X5E0F1:p.Tyr103Ala X5E0F1:p.Tyr103Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y A ecoli Escherichia coli (strain K12) physical association physical association Fig. 1, Table S4 cth-6 2 5 weight by staining molecular weight estimation by staining weight by staining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 9A q9i6a0_pseae-1 2 4 weight by staining molecular weight estimation by staining weight by staining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 9A mccb-4 2 3 weight by staining molecular weight estimation by staining weight by staining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified X5E0F1:p.Tyr103Asn X5E0F1:p.Tyr103Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y N X5E0F1:p.Tyr103Ala X5E0F1:p.Tyr103Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y A ecoli Escherichia coli (strain K12) physical association physical association Supp. Fig. 9A