IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Nature communications 2021 imex curation Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus qunliu@bnl.gov Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins qunliu@bnl.gov Accepted 2021-JUL-12 AT 13:20 BST AT 13:20 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Nature communications 2021 imex curation Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus qunliu@bnl.gov Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst structure determination identification by structure determination identification by structure determination structure determination Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins qunliu@bnl.gov Accepted 2021-JUL-12 AT 13:20 BST AT 13:20 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Structural basis for SARS-CoV-2 envelope protein recognition of human cell junction protein PALS1. Nature communications 2021 imex curation Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus qunliu@bnl.gov Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Chai J., Cai Y., Pang C., Wang L., McSweeney S., Shanklin J., Liu Q. Virus - Publications including interactions involving viral proteins qunliu@bnl.gov Accepted 2021-JUL-12 AT 13:20 BST AT 13:20 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV pals1_human Protein PALS1 PALS1 MAGUK p55 subfamily member 5 MPP5 Membrane protein, palmitoylated 5 Protein associated with Lin-7 1 protein protein human Homo sapiens Human MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR A3B2CB594E0908CA e-pals1-1 3 4 unspecified role unspecified role neutral component neutral component purified purified ec18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified "PSG" sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 pals1-1 1 5 unspecified role unspecified role neutral component neutral component purified purified "PSG" sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 1C e-pals1-3 2 4 unspecified role unspecified role neutral component neutral component purified purified ec18 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified "PSG" sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain NT-647 fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Figure 2D