IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Nature communications 2021 imex curation Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cui.sheng@ipb.pumc.edu.cn Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins cui.sheng@ipb.pumc.edu.cn Accepted 2021-JUN-09 AT 08:42 BST AT 08:42 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Nature communications 2021 imex curation Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cui.sheng@ipb.pumc.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down weight by staining molecular weight estimation by staining weight by staining Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins cui.sheng@ipb.pumc.edu.cn Accepted 2021-JUN-09 AT 08:42 BST AT 08:42 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Nature communications 2021 imex curation Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cui.sheng@ipb.pumc.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins cui.sheng@ipb.pumc.edu.cn Accepted 2021-JUN-09 AT 08:42 BST AT 08:42 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Nature communications 2021 imex curation Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cui.sheng@ipb.pumc.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins cui.sheng@ipb.pumc.edu.cn Accepted 2021-JUN-09 AT 08:42 BST AT 08:42 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions. Nature communications 2021 imex curation Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cui.sheng@ipb.pumc.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gao X., Zhu K., Qin B., Olieric V., Wang M., Cui S. Virus - Publications including interactions involving viral proteins cui.sheng@ipb.pumc.edu.cn Accepted 2021-JUN-09 AT 08:42 BST AT 08:42 BST by ORCHARD Nature communications 2021 Only protein-protein interactions imex curation imex curation hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD tom70_human Mitochondrial import receptor subunit TOM70 TOMM70 KIAA0719 TOM70 TOMM70A Translocase of outer membrane 70 kDa subunit Translocase of outer mitochondrial membrane protein 70 Mitochondrial precursor proteins import receptor protein protein human Homo sapiens Human MAASKPVEAAVVAAAVPSSGSGVGGGGTAGPGTGGLPRWQLALAVGAPLLLGAGAIYLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHLDMNSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKENSGYLKAKQYMEEENYDKIISECSKEIDAEGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATTYVHKGLLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQRGNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKKYGLKPPTL 5AAF5CAAA8582480 orf9b_sars2 ORF9b protein Accessory protein 9b ORF-9b Protein 9b 9b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK orf9b_sars2-tomm70-15 3 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component purified purified DeltaN2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Supplementary Table 1 Only hTOM70 DeltaN2 (aas 106–608)/SARS-CoV-2 orf9b yielded measurable crystals. orf9b_sars2-tomm70-16 2 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component purified purified DeltaN3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1B orf9b_sars2-tomm70-17 4 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component purified purified DeltaN2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 1 C/D orf9b_sars2-tomm70-18 4 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 1 C/D orf9b_sars2-tomm70-19 5 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component purified purified DeltaN2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 1 E orf9b_sars2-19 5 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 1 C/D orf9b_sars2-tomm70-20 1 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O94826:p.Glu477Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Mon Jun 28 17:00:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu477Ala' O94826:p.Glu549Ile mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E I Mon Jun 28 17:31:28 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu549Ile' O94826:p.Glu549Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Mon Jun 28 17:34:14 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu549Ala' O94826:p.Asp545Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D A Mon Jun 28 17:31:00 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp545Ala' O94826:p.His583Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H Q Mon Jun 28 17:05:36 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His583Gln' ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified C-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 4D LHS, Supp. figure 3 D-H orf9b_sars2-tomm70-21 1 6 unspecified role unspecified role neutral component neutral component purified purified N-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 4E LHS orf9b_sars2-tomm70-22 1 6 competitor competitor competitor neutral component neutral component N-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 4E RHS The binding affinity of the N-peptide to the hTOM70/SARS-CoV-2 orf9b complex was reduced by ~29 folds compared with the binding affinity of the N-peptide to the unliganded hTOM70. orf9b_sars2-tomm70-23 1 6 competitor competitor competitor neutral component neutral component N-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified C-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 3B There was a~13 folds reduction in binding affinity of the N-peptide to the hTOM70/C-peptide complex compared with that between the N-peptide and the unliganded hTOM70. The C-peptide was able to block N-peptide binding. hsp90aa1-orf9b_sars2-1 1 6 unspecified role unspecified role neutral component neutral component N-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 competitor competitor competitor neutral component neutral component purified purified C-peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 3C The N-peptide has little effect on the binding affinity of the C-peptide to hTOM70.