DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Nature structural & molecular biology 2021 imex curation Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Accepted 2021-AUG-22 AT 12:25 BST AT 12:25 BST by KALPANAP Nature structural & molecular biology 2021 Only protein-protein interactions imex curation IMEx MIMIx imex curation Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Nature structural & molecular biology 2021 imex curation Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Only protein-protein interactions imex curation in vitro In vitro 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Accepted 2021-AUG-22 AT 12:25 BST AT 12:25 BST by KALPANAP Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Structural basis for bacterial lipoprotein relocation by the transporter LolCDE. Nature structural & molecular biology 2021 imex curation Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tang X., Chang S., Zhang K., Luo Q., Zhang Z., Wang T., Qiao W., Wang C., Shen C., Zhang Z., Zhu X., Wei X., Dong C., Zhang X., Dong H. c.dong@uea.ac.uk; xzhang1999@zju.edu.cn; haohaodong@scu.edu.cn Accepted 2021-AUG-22 AT 12:25 BST AT 12:25 BST by KALPANAP Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation lolc_ecoli Lipoprotein-releasing system transmembrane protein LolC lolC ycfU b1116 JW5161 protein protein ecoli Escherichia coli (strain K12) MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE DIP protein P0ADC3 original sequence version: 46 lpp LPP peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide ecoli Escherichia coli (strain K12) CSSNAKIDQL lola_ecoli Outer-membrane lipoprotein carrier protein yzzV P20 lolA lplA b0891 JW0874 protein protein ecoli Escherichia coli (strain K12) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK DIP protein P61316 original sequence version: 77 F2884D82D8DFEF1D lole_ecoli Lipoprotein-releasing system transmembrane protein LolE lolE b1118 JW1104 ycfW protein protein ecoli Escherichia coli (strain K12) MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILAVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDAGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGDIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFLSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ 37B73A6E5DC58517 lold_ecoli Lipoprotein-releasing system ATP-binding protein LolD ycfV JW5162 b1117 lolD protein protein ecoli Escherichia coli (strain K12) MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDTPTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPAEINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAE 1C305476182F1EFD bame_ecoli Outer membrane protein assembly factor BamE bamE smpA b2617 JW2598 protein protein ecoli Escherichia coli (strain K12) MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN DIP protein P0A937 original sequence version: 75 DIP protein P0A937 original sequence version: 87 DIP protein P0A937 original sequence version: 88 CFD8840C014AA0A2 tang-2021-2 1 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig 2, Table 1 lola-lolc-3 1 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2, Table 1 lola-lolc-4 2 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level purified purified ecoli Escherichia coli (strain K12) 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 20-203 binding region 20-203 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 2, Table 1 tang-2021-3 3 9 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Myc tag Myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed ecoli Escherichia coli (strain K12) 8 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed ecoli Escherichia coli (strain K12) 6 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 20-203 binding region 20-203 binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed ecoli Escherichia coli (strain K12) physical association physical association Fig 3D, Fig 4E