IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro light microscopy light microscopy predetermined predetermined participant predetermined Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Differential Interference Contrast (DIC) microscopy. Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] frap fluorescence recovery after photobleaching frap tag fluorescence tag visualisation by fluorescence tag fluorescence Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Understanding the phase separation characteristics of nucleocapsid protein provides a new therapeutic opportunity against SARS-CoV-2. Protein & cell 2021 imex curation Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro frap fluorescence recovery after photobleaching frap tag fluorescence tag visualisation by fluorescence tag fluorescence Zhao D., Xu W., Zhang X., Wang X., Ge Y., Yuan E., Xiong Y., Wu S., Li S., Wu N., Tian T., Feng X., Shu H., Lang P., Li J., Zhu F., Shen X., Li H., Li P., Zeng J. Virus - Publications including interactions involving viral proteins Nsp-12 sequence has been assumed to have the same sequence as Nsp12 used in the "Gao-2020" publication. As this publication is not listed in any references, it has been assumed to have been taken from pmid:32277040 as this uses Nsp12 and Zhiyong Lou is a corresponding author. pilongli@mail.tsinghua.edu.cn,zengjy321@tsinghua.edu.cn Accepted 2021-APR-29 AT 12:30 BST AT 12:30 BST by KALPANAP Protein & cell 2021 Only protein-protein interactions imex curation imex curation human beta-actin rna oligo rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) UCACCAACUGGGACGACAUGGAGAAAAUCU range 311-340 30-bp ssdna viral oligo,orf8 region ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GATTTCATCTAAACGAACAAACTAAAATGT p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 30-bp rna viral oligo, orf8 region rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) GAUUUCAUCUAAACGAACAAACUAAAAUGU residues 28248-28277 from NC_045512.2 residues 28248-28277 p0dtd1-pro_0000449621 Papain-like protease nsp3 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG 819 2763 cvl218 CVL218 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ds 30-bp rna viral oligo, orf8 region ds rna ds rna double stranded ribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GAUUUCAUCUAAACGAACAAACUAAAAUGU p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 pj34 PJ34 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA n-86 2 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B n-n-55 2 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C n-n-56 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 B/D/I, Supp. figure 3 SARS-CoV-2 N condensates fused and coalesced into larger ones at their intersections. Figure 1B -25 umol/L mEGFP tagged SARS-CoV-2 N protein. Figure 1D- 50 umol/L mEGFP-N Figure 1I- 375 nmol/L mEGFP-N Sodium chloride concentration >200mM n-n-57 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C n-n-58 9 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1E, (Supp. figure 4) SARS-CoV-2 N can partially freely diffuse within the condensed phase. I see no recovery whatsoever in fig. S4 n-n-59 6 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1F-H 30_bp rna viral oligo, orf8 region-n-1 9 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1K, 2C, Supp. figure 4 Addition of PARP Inhibitors CVL218 or PJ34 led to larger sizes and faster recovery rates of the fluorescence intensity of the SARS-CoV-2 N-RNA condensates than the DMSO group, in vitro. CVL218 (CHEBI:167899) PJ34 (CHEBI:167900) 30_bp rna viral oligo, orf8 region-30_bp rna viral oligo, orf8 region-1 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1I, Supp. figure 5C All truncations of the N protein retained LLPS ability, though more weakly than the full-length protein. 30_bp rna viral oligo, orf8 region-n-2 4 20 unspecified role unspecified role neutral component neutral component purified purified P0DTC9:p.Ser197Leu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S L Thu Apr 22 13:02:57 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser197Leu' P0DTC9:p.Arg203Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R K Thu Apr 22 10:30:05 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg203Lys' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0DTC9:p.Ser194Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S L Thu Apr 22 13:20:30 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser194Leu' P0DTC9:p.Ser188Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S L Thu Apr 22 13:39:00 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser188Leu' ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1N n-cvl218-1 7 20 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2A n-pj34-1 7 20 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2B 30_bp rna viral oligo, orf8 region-n-3 9 16 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2C Addition of PARP Inhibitors CVL218 or PJ34 led to larger sizes and faster recovery rates of the fluorescence intensity of the SARS-CoV-2 N-RNA condensates than the DMSO group, in vitro. 30_bp rna viral oligo, orf8 region-cvl218-1 9 19 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2C Addition of PARP Inhibitors CVL218 or PJ34 led to larger sizes and faster recovery rates of the fluorescence intensity of the SARS-CoV-2 N-RNA condensates than the DMSO group, in vitro. n-n-60 1 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2D, Supp. figure 7 Both PARP inhibitor CVL218 (CHEBI:167899) and PJ34 (CHEBI:167900) treatments resulted in a greater number of of puncta, but no change in the occupied area. 30_bp rna viral oligo, orf8 region-n-4 4 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2F-I In the presence or absence of nsp12, the sizes of SARS-CoV-2 N-RNA condensates treated with PARP inhibitor CVL218 (CHEBI:167899) or PJ34 (CHEBI:167900) were significantly larger than those of the DMSO treated group. 30_bp rna viral oligo, orf8 region-n-5 4 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2F-I In the presence or absence of nsp12, the sizes of SARS-CoV-2 N-RNA condensates treated with PARP inhibitor CVL218 (CHEBI:167899) or PJ34 (CHEBI:167900) were significantly larger than those of the DMSO treated group. 30_bp rna viral oligo, orf8 region-n-6 9 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2 K/L Fluorescence recovery rates of SARS-CoV-2 N-RNA-nsp12 condensates were faster in the PARP inhibitor -CVL218 or PJ34- treated group than those of the control treatment. 30_bp rna viral oligo, orf8 region-n-7 9 16 inhibitor inhibitor luminescence transmitter luminescence transmitter 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2 K/L Fluorescence recovery rates of SARS-CoV-2 N-RNA-nsp12 condensates were faster in the PARP inhibitor -CVL218 or PJ34- treated group than those of the control treatment. 30_bp rna viral oligo, orf8 region-cvl218-2 9 19 inhibitor inhibitor luminescence transmitter luminescence transmitter 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2 K/L Fluorescence recovery rates of SARS-CoV-2 N-RNA-nsp12 condensates were faster in the PARP inhibitor -CVL218 or PJ34- treated group than those of the control treatment. human beta_actin rna oligo-n-1 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A ds 30_bp rna viral oligo, orf8 region-n-1 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A 30_bp ssdna viral oligo-n-1 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A 30_bp rna viral oligo, orf8 region-n-8 4 18 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 8A nsp12 readily converted to amorphous condensates when mixed with viral RNA. not sure if this really is an interaction or a "coagulation"/denaturation/precipitation rep-rep-150 1 18 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp. figure 8B Overexpressed GFP-nsp12 in Vero E6 cells aggregated into asymmetric condensates of dense structure in the cytoplasm. again, like s8a not sure if this is merely the protein coming out of solution, or a real interaction. rep-rep-151 5 12 unspecified role unspecified role neutral component neutral component purified purified 13 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Supp. figure 9 A/B there is a Complex portal entry - CPX-5690 for these 2 proteins - but it is a hexadecamer, and as there is no known stoichiometry here, I have not used the CP entry. rep-rep-152 3 18 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 9 A/B there is a Complex portal entry - CPX-5742 for these 3 proteins - - as there is no known stoichiometry here, although proteins were "mixed" at 1:1:2 ratio - I have not used the CP entry, also as it does not show an interaction. 30_bp rna viral oligo, orf8 region-n-9 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 189 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 191 region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 9C although the nsp12/7/8 complex was formed "In Vitro" - I do not see how to show the fact the 3 proteins were all E.coli expressed originally? -so left the "expressed-in" as E.coli. The RdRp complex can be readily recruited into the SARS-CoV-2-N-RNA condensates. 30_bp rna viral oligo, orf8 region-n-10 4 20 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range monomeric, mutated (A206K) egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role neutral component neutral component purified purified 5' prime cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 15 unspecified role unspecified role neutral component neutral component purified purified region alexa 546 label alexa 546 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined UBL1_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 10C The ubiquitin-like domain 1 (Ubl1) of nsp3 interacting with N protein was also verified to colocalize with the condensates of SARS-CoV-2 N-RNA complex. n-rep-1 1 18 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 20 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp. figure 11 CVL218 (CHEBI:167899) or PJ34 (CHEBI:167900) treatment enhances the co-localization of SARS-CoV-2 N and nsp12. nsp7-nsp8-nsp12_sars2 SARS-CoV-2 polymerase complex NSP7:2xNSP8:NSP12 replication-transcription complex replication and transcription complex RTC central RTC C-RTC holo-RdRp complex holo-RNA-dependent RNA polymerase complex 12 enzyme enzyme nsp7_nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 enzyme enzyme nsp7_nsp8 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 enzyme enzyme nsp8_nsp12 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role nsp8_nsp12 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 208 213 208 211 213 209 209 211 physical association physical association SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction RNA-directed 5'-3' RNA polymerase of the SARS-CoV-2 coronavirus which consists of the main polymerase protein NSP12 and a stoichiometric variant of the primase complex (CPX-5690). Extends partially double-stranded RNA templates and is probably also required for transcription initiation, though the mechanism for this has yet to be determined. Complex formation enhances dsRNA binding of the individual protomers. Heterotetramer Severe acute respiratory syndrome (SARS) [EFO:0000694]: A viral respiratory infection caused by the SARS coronavirus. It is transmitted through close person-to-person contact. It is manifested with high fever, headache, dry cough and myalgias. It may progress to pneumonia and cause death. Primase complex without polymerase has a different stoichiometry (8:8). NSP12 possesses conserved motifs involved in template binding, NTP binding, and polymerization that assume a structure resembling a cupped “right hand”. The NSP7-NSP8 heterodimer binds to the index finger loop and may facilitates the interaction of NSP12 with additional components of the RNA synthesis machinery. The second NSP8 molecule binds close to the RNA template-binding channel. Accepted 2020-APR-20 by ORCHARD coronavirus