IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. Cell reports 2021 imex curation Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus NEMO is of Human origin from primers. zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Accepted 2021-DEC-16 AT 15:56 GMT AT 15:56 GMT by SIMONA Cell reports 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. Cell reports 2021 imex curation Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Only protein-protein interactions imex curation human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus HPAEpiC cells:Primary human pulmonary alveolar epithelia cells. NEMO is of Human origin from primers. zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Accepted 2021-DEC-16 AT 15:56 GMT AT 15:56 GMT by SIMONA Cell reports 2021 Only protein-protein interactions imex curation imex curation SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO. Cell reports 2021 imex curation Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Only protein-protein interactions imex curation human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N., Wu J., Shi Y., Pan X., Wu S., Hou R., Zhang Y., Zhong T., Tang H., Du W., Wang L., Wo J., Mu J., Qiu Y., Yang K., Zhang LK., Ye BC., Qi N. Coronavirus - Interactions investigated in the context of Coronavirus HPAEpiC cells:Primary human pulmonary alveolar epithelia cells. NEMO is of Human origin from primers. zhangleike@wh.iov.cn, bcye@ecust.edu.cn, qinan@zjut.edu.cn Accepted 2021-DEC-16 AT 15:56 GMT AT 15:56 GMT by SIMONA Cell reports 2021 Only protein-protein interactions imex curation imex curation nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE DIP protein Q9Y6K9 original sequence version: 85 DIP protein Q9Y6K9 original sequence version: 118 DIP protein Q9Y6K9 original sequence version: 123 DIP protein Q9Y6K9 original sequence version: 141 DIP protein Q9Y6K9 original sequence version: 125 DIP protein Q9Y6K9 original sequence version: 156 DIP protein Q9Y6K9 original sequence version: 83 DIP protein Q9Y6K9 original sequence version: 132 DIP protein Q9Y6K9 original sequence version: 124 DIP protein Q9Y6K9 original sequence version: 90 322D1037881447FF orf9b_sars2 ORF9b protein Accessory protein 9b ORF-9b Protein 9b 9b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK orf9b_sars2-ikbkg-1 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3 D/F VSV (vesicular stomatitis virus) infection. orf9b_sars2-ikbkg-2 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3 G This interaction only occurs if cells are stimulated with SARS-CoV-2 RNA. orf9b_sars2-ikbkg-3 3 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization 3 E SeV (Sendai virus) infection.