UniProt UniProt http://www.uniprot.org Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pfleiderer MM., Galej WP. Complexes were purified by multiple chromatography steps prior to gel electrophoresis. wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pfleiderer MM., Galej WP. wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Pfleiderer MM., Galej WP. Complexes were purified by multiple chromatography steps prior to gelelectrophoresis wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Pfleiderer MM., Galej WP. wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Pfleiderer MM., Galej WP. I have listed proteins marked 'hit' and with a positive logFC in the table (i.e. positive enriichment vs INTS4). I have ignored anything with a gene name which looks like "P0847_INTS14" as I have no idea what this is which means I am missing INTS14, which according to Fig. 1C should be in the Ints10 pulldown, but can't so anything about that. Figs 1D-F do not appear to show what is stated in the text, i've gone with the figure legend numbering. INTS4 pull-down was used as an internal reference against which all enrichment ratios were calculated. A minimum of 2 unique peptides with a peptide length of at least seven amino acids and a false discovery rate below 0.01 were required on the peptide and protein level. wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Pfleiderer MM., Galej WP. Complexes were purified by multiple chromatography steps prior to gel electrophoresis wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Pfleiderer MM., Galej WP. wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation Structure of the catalytic core of the Integrator complex. Structure of the catalytic core of the Integrator complex. Molecular cell 2021 imex curation Pfleiderer MM., Galej WP. wgalej@embl.fr 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Pfleiderer MM., Galej WP. Complexes were purified by multiple chromatography steps prior to cross-linking with disuccinimidyl suberate wgalej@embl.fr Accepted 2021-MAR-24 AT 09:04 GMT AT 09:04 GMT by MGT Molecular cell 2021 Only protein-protein interactions imex curation imex curation int13_human Integrator complex subunit 13 INTS13 ASUN C12orf11 Cell cycle regulator Mat89Bb homolog GCT1 Germ cell tumor 1 Protein asunder homolog Sarcoma antigen NY-SAR-95 protein protein human Homo sapiens Human MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGEFMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ 925C733184461EA6 int14_human Integrator complex subunit 14 VWA9 INTS14 C15orf44 von Willebrand factor A domain-containing protein 9 protein protein human Homo sapiens Human MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLWELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLGIGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNNGEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPLPWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKILRNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLTHAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI 5B05ED69BA6451BD int4_human Integrator complex subunit 4 MSTP093 INTS4 protein protein human Homo sapiens Human MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQNEKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKLLSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMFNDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVSPSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFSATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKLLDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGLVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKPARR D56D6480EFC962D7 tbb5_human Tubulin beta chain TUBB Tubulin beta-5 chain TUBB5 OK/SW-cl.56 protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA DIP protein P07437 original sequence version: 170 1E6CD0A36773A103 int9_human Integrator complex subunit 9 INTS9 RC74 Protein related to CPSF subunits of 74 kDa protein protein human Homo sapiens Human MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF 81F1A24B99704684 int5_human Integrator complex subunit 5 INTS5 KIAA1698 protein protein human Homo sapiens Human MSALCDPPGAPGPPGPAPATHGPAPLSAQELSQEIKAFLTGVDPILGHQLSAREHARCGLLLLRSLPPARAAVLDHLRGVFDESVRAHLAALDETPVAGPPHLRPPPPSHVPAGGPGLEDVVQEVQQVLSEFIRANPKAWAPVISAWSIDLMGQLSSTYSGQHQRVPHATGALNELLQLWMGCRATRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIISRVLSCGLKDFCVHGGAGGGAGSSGGSSSQTPSTDPFPGSPAIPAEKRVPKIASVVGILGHLASRHGDSIRRELLRMFHDSLAGGSGGRSGDPSLQATVPFLLQLAVMSPALLGTVSGELVDCLKPPAVLSQLQQHLQGFPREELDNMLNLAVHLVSQASGAGAYRLLQFLVDTAMPASVITTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPRLVPFLDALKNHVGELCGETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSPEELSLATQLYAGLVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQQGGEGPAALGAHFGESASAHLSDLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVRAGVHRFFASLRLHGPPGVASACQLLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGQVDGDNETLSVVSASLASASLLDTNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLLSLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAAGAELAWPPEEHARATVERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALLGHWEASRHPDTTHSPWHLEASCTLVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGFLREHGPLPQKFIFQSERGRFIRDFSREGGGEGGPHLAVLHSVLHRNIDRLGLFSGRFQAPSPSTLLRQGT Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes mint homomint DD4E3B0E2A60F9E7 int8_human Integrator complex subunit 8 INTS8 C8orf52 Protein kaonashi-1 protein protein human Homo sapiens Human MSAEAADREAATSSRPCTPPQTCWFEFLLEESLLEKHLRKPCPDPAPVQLIVQFLEQASKPSVNEQNQVQPPPDNKRNRILKLLALKVAAHLKWDLDILEKSLSVPVLNMLLNELLCISKVPPGTKHVDMDLATLPPTTAMAVLLYNRWAIRTIVQSSFPVKQAKPGPPQLSVMNQMQQEKELTENILKVLKEQAADSILVLEAALKLNKDLYVHTMRTLDLLAMEPGMVNGETESSTAGLKVKTEEMQCQVCYDLGAAYFQQGSTNSAVYENAREKFFRTKELIAEIGSLSLHCTIDEKRLAGYCQACDVLVPSSDSTSQQLTPYSQVHICLRSGNYQEVIQIFIEDNLTLSLPVQFRQSVLRELFKKAQQGNEALDEICFKVCACNTVRDILEGRTISVQFNQLFLRPNKEKIDFLLEVCSRSVNLEKASESLKGNMAAFLKNVCLGLEDLQYVFMISSHELFITLLKDEERKLLVDQMRKRSPRVNLCIKPVTSFYDIPASASVNIGQLEHQLILSVDPWRIRQILIELHGMTSERQFWTVSNKWEVPSVYSGVILGIKDNLTRDLVYILMAKGLHCSTVKDFSHAKQLFAACLELVTEFSPKLRQVMLNEMLLLDIHTHEAGTGQAGERPPSDLISRVRGYLEMRLPDIPLRQVIAEECVAFMLNWRENEYLTLQVPAFLLQSNPYVKLGQLLAATCKELPGPKESRRTAKDLWEVVVQICSVSSQHKRGNDGRVSLIKQRESTLGIMYRSELLSFIKKLREPLVLTIILSLFVKLHNVREDIVNDITAEHISIWPSSIPNLQSVDFEAVAITVKELVRYTLSINPNNHSWLIIQADIYFATNQYSAALHYYLQAGAVCSDFFNKAVPPDVYTDQVIKRMIKCCSLLNCHTQVAILCQFLREIDYKTAFKSLQEQNSHDAMDSYYDYIWDVTILEYLTYLHHKRGETDKRQIAIKAIGQTELNASNPEEVLQLAAQRRKKKFLQAMAKLYF 24D06E11821BD4D5 int10_human Integrator complex subunit 10 INTS10 C8orf35 protein protein human Homo sapiens Human MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTEQCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQIENQHQGAQDTSDLMSPSKRSSQKYIIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEIDRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESWELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT DIP protein Q9NVR2 original sequence version: 67 3E9945064EC4BEFB cg026_human Uncharacterized protein C7orf26 C7orf26 protein protein human Homo sapiens Human MSDIRHSLLRRDALSAAKEVLYHLDIYFSSQLQSAPLPIVDKGPVELLEEFVFQVPKERSAQPKRLNSLQELQLLEIMCNYFQEQTKDSVRQIIFSSLFSPQGNKADDSRMSLLGKLVSMAVAVCRIPVLECAASWLQRTPVVYCVRLAKALVDDYCCLVPGSIQTLKQIFSASPRFCCQFITSVTALYDLSSDDLIPPMDLLEMIVTWIFEDPRLILITFLNTPIAANLPIGFLELTPLVGLIRWCVKAPLAYKRKKKPPLSNGHVSNKVTKDPGVGMDRDSHLLYSKLHLSVLQVLMTLQLHLTEKNLYGRLGLILFDHMVPLVEEINRLADELNPLNASQEIELSLDRLAQALQVAMASGALLCTRDDLRTLCSRLPHNNLLQLVISGPVQQSPHAALPPGFYPHIHTPPLGYGAVPAHPAAHPALPTHPGHTFISGVTFPFRPIR CECD14EB3E97A6BA int11_human Integrator complex subunit 11 INTS11 CPSF3L Cleavage and polyadenylation-specific factor 3-like protein Protein related to CPSF subunits of 68 kDa RC68 protein protein human Homo sapiens Human MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS 47C4E2E16202B130 ints5-ints11-1 5 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1B, Supp Table 1 ints10-c7orf26-1 5 16 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 1C, Supp Table 1 ints8-ints5-1 1 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 1D ints11-ints4-1 1 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1D, Supp. figure 2A ints13-ints10-1 1 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1D ints10-ints11-1 2 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Supp. Fig. 1A ints11-ints10-2 2 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Supp. Fig. 1A ints5-ints8-1 3 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 1E. 1F, Supp. Figs. 1B, 1C ints11-ints4-2 3 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1E, 1F, Supp. 1B ints13-ints10-2 4 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Supp. 1C ints11-ints4-3 7 18 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5TA45:p.Lys462Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Thu Apr 22 13:34:58 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys462Glu' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q5TA45:p.[His480Pro;Thr482Pro] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain F P certain certain sequence position certain certain certain sequence position certain T P Q5TA45:p.[Val454Pro;Gly455Pro] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain VG PP Q5TA45:p.[Phe490Pro;Leu492Pro] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain F P certain certain sequence position certain certain certain sequence position certain L P region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 4A The Q5TA45:p.[Arg510Pro;Thr512Pro] mutation results in reduced expression of INTS11 ints9-ints11-3 7 18 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q5TA45:p.Glu203Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E Q Thu Apr 22 13:27:40 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu203Gln' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Q5TA45:p.[His480Pro;Thr482Pro] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H P certain certain sequence position certain certain certain sequence position certain T P Q5TA45:p.Val454_Gly455delinsProPro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain VG PP Mon Mar 01 11:09:18 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q5TA45:p.[Val454Pro;Gly482Pro]' Thu Apr 22 11:52:41 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q5TA45:p.[Thr454_Gly455delinsProPro]' Q5TA45:p.[Phe490Pro;Leu492Pro] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F P certain certain sequence position certain certain certain sequence position certain L P 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A, Supp. Fig.1H The Q5TA45:p.[Arg510Pro;Thr512Pro] mutation results in reduced expression of INTS11. ints11-ints4-4 8 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined sequence tag sequence tag identification sequence tag unspecified role unspecified role bait bait purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey purified purified 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined sequence tag sequence tag identification sequence tag unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.4C ints11-ints4-6 6 18 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified 11 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 1, Video S1 ints13-ints10-4 3 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1E, 1F, Supp. Figs. 1B, 1C ints9-ints11-4 7 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4A