UniProt UniProt http://www.uniprot.org The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. COPS5 (Q92905) was also identified as an interactor but authors believe this to be a false positive result arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Universal normalized human cDNA Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. The uncharacterized protein FAM47E interacts with PRMT5 and regulates its functions. Life science alliance 2021 imex curation Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chakrapani B., Khan MIK., Kadumuri RV., Gupta S., Verma M., Awasthi S., Govindaraju G., Mahesh A., Rajavelu A., Chavali S., Dhayalan A. arun.dbt@pondiuni.edu.in Accepted 2021-JAN-19 AT 12:57 GMT AT 12:57 GMT by MGT Life science alliance 2021 Only protein-protein interactions imex curation imex curation o14744-1 Protein arginine N-methyltransferase 5 72 kDa ICln-binding protein Histone-arginine N-methyltransferase PRMT5 Jak-binding protein 1 Shk1 kinase-binding protein 1 homolog PRMT5 HRMT1L5 IBP72 JBP1 SKB1 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL 522E255B384F25E7 ptx3_human_gene Pentraxin-related protein PTX3 PTX3 TNFAIP5 TSG14 gene gene human Homo sapiens Human q9une7-1 E3 ubiquitin-protein ligase CHIP STUB1 CHIP Antigen NY-CO-7 CLL-associated antigen KW-8 Carboxy terminus of Hsp70-interacting protein RING-type E3 ubiquitin transferase CHIP STIP1 homology and U box-containing protein 1 PP1131 protein protein human Homo sapiens Human MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY DIP protein Q9UNE7-1 original sequence version: 134 DIP protein Q9UNE7-1 original sequence version: 56 DIP protein Q9UNE7 original sequence version: 87 q9bqa1-1 Methylosome protein 50 Androgen receptor cofactor p44 WD repeat-containing protein 77 p44/Mep50 HKMT1069 Nbla10071 WDR77 MEP50 WD45 protein protein human Homo sapiens Human MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE 3D355AEC68491ECB dclk1_human_gene Serine/threonine-protein kinase DCLK1 DCLK1 DCAMKL1 DCDC3A KIAA0369 gene gene human Homo sapiens Human anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL DIP protein O14744 original sequence version: 86 DIP protein O14744 original sequence version: 104 DIP protein O14744-1 original sequence version: 148 DIP protein O14744-1 original sequence version: 114 DIP protein O14744 original sequence version: 146 522E255B384F25E7 fa47e_human Protein FAM47E FAM47E protein protein human Homo sapiens Human MADRRRRLRPGTLAPVREGVNCRSRCFTKHKNGLKFPTSLHSRQLVFPRKGLDDFRKGCPPCTGLVTQVPVEGFLPQIYHRAPQLAPKKRQIKLLKEADVLSKLSPAQQARKAFLEDVEAHLTPHPLALYLNLEEAMPIELLSKVLEVLDPDRKLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEEKPHKMDLLHENGPRPGLHENGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSKLQETEFFQKLGYERKLQKPQNPYKPKWVKMRYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQEELLADLHGTVAFKDFILSRGYRTPRFLENMYIGKECKRACNKTPIKRTQA 0945D3CDA7B471F8 pyr1_human_gene PYR1_HUMAN_GENE/CAD gene gene human Homo sapiens Human tnap3_human_gene Tumor necrosis factor alpha-induced protein 3 (TNFAIP3) human gene gene gene human Homo sapiens Human ccnd1_human_gene Human Cyclin D1 gene gene gene human Homo sapiens Human q6zv65-2 Protein FAM47E FAM47E protein protein human Homo sapiens Human MQMSVPCVLSSLQNHEPNKPLFTTQSQLLSKVLEVLDPDRKLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEEKPHKMDLLHENGPRPGLHENVCKAVSDFCKWVTTFGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSKLQETEFFQKLGYERKLQKPQNPYKPKWVKMRYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQEELLADLHGTVAFKDFILSRGYRTPRFLENMYIGKECKRACNKTPIKRTQA FB51DE1D9CAA904D fam47e-prmt5-1 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association However, we obtained FAM47E isoform 2 as putative interaction partner of PRMT5 in our Y2H screening. prmt5-fam47e-1 3 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 1A Next, we validated PRMT5–FAM47E interaction in Y2H assay by using full-length FAM47E isoform 2 (hereafter referred as FAM47E) with appropriate vector controls. fam47e-prmt5-2 4 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B To confirm the PRMT5-FAM47E interaction in vivo, we performed the co-immunoprecipitation (Co-IP) experiments by co-expressing Myc-tagged PRMT5 with GFP or GFP-tagged FAM47E in HEK293 cells.. prmt5-fam47e-2 4 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C Similarly, we co-expressed HA-tagged FAM47E with GFP or GFP-tagged PRMT5 for reverse Co-IP experiments. fam47e-prmt5-3 7 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1D We found that GFP-FAM47E efficiently co-precipitated the endogenous PRMT5 suggesting thatFAM47E could interact with endogenous levels of PRMT5 (Fig 1D). fam47e-prmt5-4 2 8 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 18 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1E To assess whether PRMT5 directly interacts with FAM47E, we carried out a GST pull-down assay using recombinant GST-tagged FAM47E and His-tagged PRMT5 proteins. fam47e-prmt5-5 5 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1F We found that immunoprecipitation of FAM47E antibody efficiently co-precipitated the PRMT5 (Fig 1F) and similarly immunoprecipitation of PRMT5 antibody efficiently co-precipitated the FAM47E (Fig 1G). prmt5-fam47e-3 5 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1G We found that immunoprecipitation of FAM47E antibody efficiently co-precipitated the PRMT5 (Fig 1F) and similarly immunoprecipitation of PRMT5 antibody efficiently co-precipitated the FAM47E (Fig 1G). fam47e-wdr77-1 4 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 2A For this, we performed co-immunoprecipitation by co-expressing GFP or GFP-FAM47E with Myc-tagged MEP50 in HEK293 cells and found that FAM47E interacts with MEP50 (Fig S2A). prmt5-wdr77-10 4 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp fig 2B The presence of FAM47E did not affect PRMT5-WDR77 interaction. prmt5-stub1-1 4 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 7 Over-expression of FAM47E did not affect the PRMT5-CHIP interaction whereas the over-expression of FAM47E slightly increased the PRMT5-CHIP interaction prmt5-pyr1_human_gene-1 6 15 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GTGGGAGGGACTGCTTTAGG CGGCAGCAGCAGAGACTG chr2:27217216-27217385 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C fam47e-pyr1_human_gene-1 6 15 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GTGGGAGGGACTGCTTTAGG CGGCAGCAGCAGAGACTG chr2:27217216-27217385 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C prmt5-ccnd1_human_gene-1 6 17 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr11:69640914-69641086 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C fam47e-ccnd1_human_gene-1 6 17 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr11:69640914-69641086 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C prmt5-dclk1-1 6 12 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr13:36131579-36131598 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C fam47e-dclk1-1 6 12 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr13:36131579-36131598 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C prmt5-dclk1-2 6 12 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chr13:36131579-36131598 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C prmt5-ptx3-1 6 9 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAAGTAGCTGGAATTACAGG TGTCATAGGCCGGGTGAGG 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C fam47e-ptx3-1 6 9 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CAAGTAGCTGGAATTACAGG TGTCATAGGCCGGGTGAGG 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C prmt5-tnap3_human_gene-1 6 16 unspecified role unspecified role prey prey cell lysate cell lysate promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GCAGTCTGCAGTCTTCGTG CTCCGGGCCCCGCGATCC 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 5C