DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu BAK core dimers bind lipids and can be bridged by them. BAK core dimers bind lipids and can be bridged by them. Nature structural & molecular biology 2020 imex curation Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2021-JUN-04 AT 11:07 BST AT 11:07 BST by ORCHARD Nature structural & molecular biology 2020 imex curation BAK core dimers bind lipids and can be bridged by them. BAK core dimers bind lipids and can be bridged by them. Nature structural & molecular biology 2020 imex curation Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Cowan AD., Smith NA., Sandow JJ., Kapp EA., Rustam YH., Murphy JM., Brouwer JM., Bernardini JP., Roy MJ., Wardak AZ., Tan IK., Webb AI., Gulbis JM., Smith BJ., Reid GE., Dewson G., Colman PM., Czabotar PE. czabotar@wehi.edu.au, pcolman@wehi.edu.au Accepted 2021-JUN-04 AT 11:07 BST AT 11:07 BST by ORCHARD Nature structural & molecular biology 2020 imex curation q16611-1 Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS A2200FE72A46D04E bak1-26 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role purified purified 68-148 Binding Region 68-148 Binding Region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 1, Table 1 bak1-27 2 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.His164Cys H164C mutation mutation certain certain sequence position certain certain certain sequence position certain H C Mon Jun 28 17:45:46 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[His164Cys]' Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain M C certain certain sequence position certain certain certain sequence position certain K C certain certain sequence position certain certain certain sequence position certain H C Mon Jun 28 16:52:25 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met71Cys,Lys113Cys,His164Cys]' mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. direct interaction direct interaction Fig 5b bak1-28 2 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain M C certain certain sequence position certain certain certain sequence position certain K C certain certain sequence position certain certain certain sequence position certain H C Mon Jun 28 17:36:06 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met71Cys,Lys113Cys,His164Cys]' Q16611-1:p.Trp125Pro W125P mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W P Mon Jun 28 17:31:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp125Pro]' Q16611-1:p.Tyr136Phe Y136F mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Mon Jun 28 17:15:44 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr136Phe]' Q16611-1:p.Arg137Ala R137A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 16:53:21 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg137Ala]' mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. direct interaction direct interaction Fig 5d bak1-29 2 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain M C certain certain sequence position certain certain certain sequence position certain K C certain certain sequence position certain certain certain sequence position certain H C Mon Jun 28 17:36:31 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611-1:p.[Met71Cys,Lys113Cys,His164Cys]' Q16611-1:p.Trp125Pro W125P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W P Mon Jun 28 17:12:01 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611-1p.Trp125Pro' Q16611-1:p.Tyr136Phe Y136F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Mon Jun 28 17:19:10 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611-1:p.Tyr136Phe' Q16611-1:p.Arg137Ala R137A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 17:25:15 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611-1p.Arg137Ala' mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. 3 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component partially purified partially purified Q16611-1:p.[Met71Cys;Lys113Cys;His164Cys] M71C/K113C/H164C mutation mutation certain certain sequence position certain certain certain sequence position certain M C certain certain sequence position certain certain certain sequence position certain K C certain certain sequence position certain certain certain sequence position certain H C Mon Jun 28 17:39:14 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Met71Cys,Lys113Cys,His164Cys]' Q16611-1:p.Trp125Pro W125P mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W P Mon Jun 28 17:28:05 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611:p.Trp125Pro' Q16611-1:p.Tyr136Phe Y136F mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Mon Jun 28 17:08:27 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611:p.Tyr136Phe' Q16611-1:p.Arg137Ala R137A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 17:14:32 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'q16611:p.Arg137Ala' mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. direct interaction direct interaction Fig 5d