DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Sub-2 Angstrom resolution structure determination using single-particle cryo-EM at 200 keV. Sub-2 Angstrom resolution structure determination using single-particle cryo-EM at 200 keV. Journal of structural biology: X 2019 imex curation Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Accepted 2021-JUL-03 AT 18:01 BST AT 18:01 BST by KALPANAP Journal of structural biology: X 2019 Only protein-protein interactions imex curation imex curation Sub-2 Angstrom resolution structure determination using single-particle cryo-EM at 200 keV. Sub-2 Angstrom resolution structure determination using single-particle cryo-EM at 200 keV. Journal of structural biology: X 2019 imex curation Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Wu M., Lander GC., Herzik MA. mherzik@ucsd.edu Accepted 2021-JUL-03 AT 18:01 BST AT 18:01 BST by KALPANAP Journal of structural biology: X 2019 Only protein-protein interactions imex curation imex curation frih_mouse Ferritin heavy chain Fth1 Fth protein protein mouse Mus musculus Mouse MTTASPSQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTLGHGDES 129A8887A2BC650B aldoa_rabit Fructose-bisphosphate aldolase A ALDOA Muscle-type aldolase protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISNHAY mint E61BCBC60F668324 fth1-14 2 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2, Supplementary Fig 3, Table 1 aldoa-1 1 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1, Supplementary Fig 1, Table 1