UniProt UniProt http://www.uniprot.org INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. pull down pull down western blot western blot Immuno blot Immuno blot Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Only intramolecular links shown Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink sequence tag sequence tag identification sequence tag Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Only intramolecular links shown Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. INTS10-INTS13-INTS14 form a functional module of Integrator that binds nucleic acids and the cleavage module. Nature communications 2020 imex curation Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. stefanie.jonas@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight by staining molecular weight estimation by staining weight by staining Sabath K., Stäubli ML., Marti S., Leitner A., Moes M., Jonas S. Only intramolecular links shown Disuccinimidyl suberate (DSS) was used to covalently link lysine residues with a distance between C-alpha atoms of less than 26-30 A. stefanie.jonas@mol.biol.ethz.ch Accepted 2021-AUG-03 AT 12:10 BST AT 12:10 BST by KALPANAP Nature communications 2020 Only protein-protein interactions imex curation imex curation int10_human Integrator complex subunit 10 INTS10 C8orf35 protein protein human Homo sapiens Human MSAQGDCEFLVQRARELVPQDLWAAKAWLITARSLYPADFNIQYEMYTIERNAERTATAGRLLYDMFVNFPDQPVVWREISIITSALRNDSQDKQTQFLRSLFETLPGRVQCEMLLKVTEQCFNTLERSEMLLLLLRRFPETVVQHGVGLGEALLEAETIEEQESPVNCFRKLFVCDVLPLIINNHDVRLPANLLYKYLNKAAEFYINYVTRSTQIENQHQGAQDTSDLMSPSKRSSQKYIIEGLTEKSSQIVDPWERLFKILNVVGMRCEWQMDKGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGDVEIDRNKHIHKKRKLAEGREKTMSSDDEDCSAKGRNRHIVVNKAELANSTEVLESFKLARESWELLYSLEFLDKEFTRICLAWKTDTWLWLRIFLTDMIIYQGQYKKAIASLHHLAALQGSISQPQITGQGTLEHQRALIQLATCHFALGEYRMTCEKVLDLMCYMVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACFKLRAFTDNRDDMALGHVIVLLQQEWPRGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFCINEKILLLQTLT DIP protein Q9NVR2 original sequence version: 67 3E9945064EC4BEFB u1_human_snrna Human U1 spliceosomal RNA snrna small nuclear rna snRNA snrna human Homo sapiens Human AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGUGCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG Rfam xref RF00003 u12_snrna_human U12 small nuclear (RNU12) snrna small nuclear rna snRNA snrna human Homo sapiens Human int14_human Integrator complex subunit 14 VWA9 INTS14 C15orf44 von Willebrand factor A domain-containing protein 9 protein protein human Homo sapiens Human MPTVVVMDVSLSMTRPVSIEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLWELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLGIGRGSLRHSLATQNQRSESNRFPLPFPFPSKLYIMCMANLEELQSTDSLECLERLIDLNNGEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPLPWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKILRNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPETAHPDAAFQLTHAAQQLKLASTGTSEYAAYDQNITPLHTDFSGSSTERI 5B05ED69BA6451BD int7_human Integrator complex subunit 7 INTS7 C1orf73 protein protein human Homo sapiens Human MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPILINSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARAITLRMLGSLASIIPERKNAHHSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKISEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTSYPSTKMVIVSLHTFTLLAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECALQTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQECCYHNNRGIAAHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLAKGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAIAMQLPVLGDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKGIASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATLRNVELQQQSCLLISHAIEALILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVESLNRKYTPVSYMHTACLCNAIIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSKPGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILGTHNITVESSVKDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYTRF 45253FE31FD5B96D int4_human Integrator complex subunit 4 MSTP093 INTS4 protein protein human Homo sapiens Human MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQNEKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSLEKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKLLSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRVQAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPKEEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMFNDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKEGIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMDDPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVSPSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFSATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVVIIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKLLDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGLVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSHTAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKPARR D56D6480EFC962D7 int9_human Integrator complex subunit 9 INTS9 RC74 Protein related to CPSF subunits of 74 kDa protein protein human Homo sapiens Human MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF 81F1A24B99704684 hsur4_shv2c_mirna mirna micro rna micro RNA micro-RNA micro-rna mirna miRNA shv2c Saimiriine herpesvirus 2 (strain 488) (SaHV-2) Herpesvirus saimiri int11_human Integrator complex subunit 11 INTS11 CPSF3L Cleavage and polyadenylation-specific factor 3-like protein Protein related to CPSF subunits of 68 kDa RC68 protein protein human Homo sapiens Human MPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYRKIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKVGSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHETVERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQKIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKGLPQAPS 47C4E2E16202B130 int1_human Integrator complex subunit 1 INTS1 KIAA1440 UNQ1821/PRO3434 protein protein human Homo sapiens Human MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSERKRDAAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAISPSIKEPSVVPIEVLPTVLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLSLMYLAKIKPNIFATEGVIEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENWPEIFVKVYIEDSLGERIWVDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGAGSSPHPSLTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGSEDMDVISHLIKIRLKPKVLLNHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNNMQVLYTALQHSSELAPKFLAMVFQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCLGLMQERKEPQYLEMEFKERFVVHITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSISKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIGLSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLPPGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPCTLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQGPPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSEGSLDVLPVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLLLGPKADEQTTCEVLDYFLRRLGSSQVASRVLAMKGLSLVLSEGSLRDGEEKEPPMEEDVGDTDVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHMETDPQTISAYLIYLSQHTPVEEQAQHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAVLSALLSIFSRYVRRMRQSKEGEEVYSWSESQDQVFLRWSSGETATMHILVVHAMVILLTLGPPRADDSEFQALLDIWFPEEKPLPTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSKLLQFLDQAVAHDPQTLEQNIMDKNYMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTEAPKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALALQQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQLCQYQRCVPQDTGFSSLFLKVLLQMLQWLDSPGVEGGPLRAQLRMLASQASAGRRLSDVRGGLLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEPDLISKVLQGLIEVRSPHLEELLTAFFSATADAASPFPACKPVVVVSSLLLQEEEPLAGGKPGADGGSLEAVRLGPSSGLLVDWLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLLTLFTHQSSWPTLHQCIRVLLGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQKRREELVLRVQGPELISLVELILAEAETRSQDGDTAACSLIQARLPLLLSCCCGDDESVRKVTEHLSGCIQQWGDSVLGRRCRDLLLQLYLQRPELRVPVPEVLLHSEGAASSSVCKLDGLIHRFITLLADTSDSRALENRGADASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCFLHVLGLLELLQPHVFRSEHQGALWDCLLSFIRLLLNYRKSSRHLAAFINKFVQFIHKYITYNAPAAISFLQKHADPLHDLSFDNSDLVMLKSLLAGLSLPSRDDRTDRGLDEEGEEESSAGSLPLVSVSLFTPLTAAEMAPYMKRLSRGQTVEDLLEVLSDIDEMSRRRPEILSFFSTNLQRLMSSAEECCRNLAFSLALRSMQNSPSIAAAFLPTFMYCLGSQDFEVVQTALRNLPEYALLCQEHAAVLLHRAFLVGMYGQMDPSAQISEALRILHMEAVM DIP protein Q8N201 original sequence version: 53 342FF560BF3F61F6 int13_human Integrator complex subunit 13 INTS13 ASUN C12orf11 Cell cycle regulator Mat89Bb homolog GCT1 Germ cell tumor 1 Protein asunder homolog Sarcoma antigen NY-SAR-95 protein protein human Homo sapiens Human MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSMEYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAGRHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSHLGGGSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGEFMRENRLTPFLDPRYKIDGSLEVPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASVIVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLVRAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKSWQDSERLKGILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ 925C733184461EA6 ints13-ints14-1 10 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NVM9:p.[Thr53Glu;Met102Glu;Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain T E Q9NVM9:p.[Thr53Glu;Met102Glu;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain F E Mon Mar 01 10:48:34 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Thr53Glu;Met102Glu;Phe481Glu;Leu427Gly]' Tue Oct 05 19:05:55 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Met102Glu;Thr53Glu;Phe418Glu;Leu427Glu]' Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 11:18:03 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Gly]' Q9NVM9:p.[Thr53Glu;Met102Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain M E Mon Mar 01 10:53:25 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Thr53Glu;Met102Glu]' Q9NVM9:p.[Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E Q9NVM9:p.[Ile395Glu;Leu396Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain IL E Q9NVM9:p.[Phe418Glu;Leu427Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 10:55:06 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Phe418Glu;Leu427Gly]' physical association physical association Fig. 1A, 2I, Supp. Fig. 1D ints14-ints13-1 10 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q96SY0:p.[Pro371Glu;Tyr399Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E Q96SY0:p.[Phe256Glu;Ser264Glu;Leu312Glu;Trp362Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Mon Mar 01 11:15:47 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q96SY0:p.[Ser264Glu;Phe256Glu;Leu312Glu;Trp362Glu]' Q96SY0:p.[Phe447Glu;Phe449Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain F E Q96SY0:p.[Ser264Glu;Trp362Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Q96SY0:p.Leu272Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 11:00:14 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q96SY0:p.[Leu272Glu]' Q96SY0:p.[Phe256Glu;Leu312Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E physical association physical association Fig. 1B, 2J, Supp. Fig. 1E ints13-ints14-2 6 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1C, Supp. Fig. 1A ints13-ints14-3 4 15 unspecified role unspecified role neutral component neutral component purified purified 22 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 1D, Supp Table 1 ints13-ints14-4 9 15 unspecified role unspecified role neutral component neutral component purified purified Q96SY0:lys-394 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-394 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-442 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-386 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-425 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-386 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-435 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-376 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96SY0:lys-425 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role neutral component neutral component purified purified Q9NVM9:lys-73 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-549 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-436 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-507 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-436 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-35 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-454 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-35 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 60 74 61 73 62 75 76 63 64 77 65 78 79 66 67 80 68 81 82 69 70 83 84 71 direct interaction direct interaction Fig. 1G, Supp Data 1 ints1-ints10-1 1 15 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3A ints11-ints4-5 1 20 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3A ints10-ints13-1 1 15 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3A ints13-ints10-3 2 15 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NVM9:p.[Thr53Glu;Met102Glu;Leu328Glu;Tyr330Gly] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain T E Q9NVM9:p.[Thr53Glu;Met102Glu;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain F E Mon Mar 01 11:28:52 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Thr53Glu;Met102Glu;Phe481Glu;Leu427Gly]' Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 11:21:47 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Gly]' association association Fig. 3B ints14-ints10-1 2 22 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E Q96SY0:p.[Ser264Glu;Phe256Glu;Leu312Glu;Trp362Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E association association Fig. 3C,3D ints14-ints10-2 10 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q96SY0:p.[Ser264Glu;Trp362Glu;Pro371Glu;Tyr399Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Q96SY0:p.[Phe256Glu;Leu312Glu;Pro371Glu;Tyr399Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain P E certain certain sequence position certain certain certain sequence position certain Y E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E Q96SY0:p.[Phe256Glu;Ser264Glu;Leu312Glu;Trp362Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain W E Mon Mar 01 11:49:53 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q96SY0:p.[Ser264Glu;Phe256Glu;Leu312Glu;Trp362Glu]' vwa region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q96SY0:p.[Asp8Ala;Ser10Ala;Ser12Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain D A Q96SY0:p.[Leu11Glu;Arg15Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain R A physical association physical association Fig. 3C, 3D, 3H ints14-ints13-2 2 22 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 15 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3D ints14-ints13-3 8 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ecoli Escherichia coli (strain K12) 15 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 3E u1_human_snrna-1 11 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined stem loop 4 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fug. 4A, 4B u1_human_snrna-ints10-1 11 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined stem loop 4 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fug. 4A, 4B u1_human_snrna-ints13-1 7 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4E, 4F, Supp Fig 6G In low salt condition the complex displays 7-fold higher affinity for the RNA. u1_human_snrna-ints10-2 7 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fug. 4E, 4F, Supp Fig. 6G, 6H In low salt condition the complex displays 18-fold higher affinity for the RNA. ints13-ints14-5 5 20 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 17 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 5A ints13-ints11-1 5 20 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 17 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 5A ints13-ints11-2 5 20 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 17 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 weight by comassie molecular weight estimation by coomasie staining weight by comassie western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 5B, Supp. Fig. 7B ints13-ints14-6 2 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Gly] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 5C ints13-ints1-1 2 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 11:37:53 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Leu328Glu;Tyr330Gly;Phe418Glu;Leu427Gly]' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 5C, Supp. Fig. 7A ints13-ints14-7 3 15 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Supp. Fig. 4D ints13-ints14-8 3 15 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction Supp. Fig. 4D ints13-ints13-1 10 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig. 4E ints14-ints13-4 10 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp Fig. 4E ints13-ints14-9 2 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sbp sbp n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9NVM9:p.[Thr53Glu;Met102Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T E certain certain sequence position certain certain certain sequence position certain M E Mon Mar 01 11:00:04 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Thr53Glu;Met102Glu]' Q9NVM9:p.[Leu328Glu;Tyr330Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y G certain certain sequence position certain certain certain sequence position certain L E Q9NVM9:p.Ile395_Leu396delinsGluGlu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain IL EE Q9NVM9:p.[Phe418Glu;Leu427Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F E certain certain sequence position certain certain certain sequence position certain L E Mon Mar 01 10:56:43 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NVM9:p.[Phe418Glu;Leu427Gly]' association association Supp. Fig. 5A ints13-ints14-10 3 12 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role neutral component neutral component purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Supp. Fig. 5B hsur4_shv2c_mirna-ints10-1 11 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 19 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 6K In low salt condition the complex displays 18-fold higher affinity for the RNA. hsur4_shv2c_mirna-ints13-1 11 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 19 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 6K In low salt condition the complex displays 18-fold higher affinity for the RNA. u12_snrna_human-ints10-1 7 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 12 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 14 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp Fig. 6I, 6J u12_snrna_human-ints13-1 7 15 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 22 unspecified role unspecified role prey prey purified purified n-terminal strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 14 unspecified role unspecified role bait bait 3-prime box region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp Fig 6I, 6J ints11-ints13-1 9 22 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-690 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-690 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NVM9:lys-668 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 20 unspecified role unspecified role neutral component neutral component purified purified Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-223 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-224 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-419 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-475 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-223 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-303 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-475 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-234 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-426 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-486 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-292 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-522 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-369 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q5TA45:lys-500 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 18 unspecified role unspecified role neutral component neutral component purified purified Q9NV88:lys-159 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-374 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-193 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-510 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-159 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q9NV88:lys-170 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 17 unspecified role unspecified role neutral component neutral component purified purified Q96HW7:lys-324 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-217 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-324 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-437 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-157 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-198 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-340 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-495 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-157 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-959 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-217 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-164 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain Q96HW7:lys-62 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 281 352 282 353 313 283 314 284 315 285 287 331 288 332 289 333 321 290 335 291 336 292 293 337 294 338 295 339 340 296 341 297 342 298 299 343 344 300 345 301 302 346 347 303 304 348 322 305 323 306 307 324 325 308 326 309 310 327 311 328 312 329 317 349 334 318 350 319 351 320 physical association physical association Supp.Fig.7C, Supp.Table 2