MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Paracaspase MALT1 regulates glioma cell survival by controlling endo-lysosome homeostasis. Paracaspase MALT1 regulates glioma cell survival by controlling endo-lysosome homeostasis. The EMBO journal 2020 imex curation Jacobs KA., André-Grégoire G., Maghe C., Thys A., Li Y., Harford-Wright E., Trillet K., Douanne T., Alves Nicolau C., Frénel JS., Bidère N., Gavard J. Brain Disease - Neurological Diseases & Disorders julie.gavard@inserm.fr Only protein-protein interactions imex curation human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jacobs KA., André-Grégoire G., Maghe C., Thys A., Li Y., Harford-Wright E., Trillet K., Douanne T., Alves Nicolau C., Frénel JS., Bidère N., Gavard J. Brain Disease - Neurological Diseases & Disorders julie.gavard@inserm.fr Accepted 2021-JUN-21 AT 19:07 BST AT 19:07 BST by KALPANAP The EMBO journal 2020 Only protein-protein interactions imex curation imex curation Paracaspase MALT1 regulates glioma cell survival by controlling endo-lysosome homeostasis. Paracaspase MALT1 regulates glioma cell survival by controlling endo-lysosome homeostasis. The EMBO journal 2020 imex curation Jacobs KA., André-Grégoire G., Maghe C., Thys A., Li Y., Harford-Wright E., Trillet K., Douanne T., Alves Nicolau C., Frénel JS., Bidère N., Gavard J. Brain Disease - Neurological Diseases & Disorders julie.gavard@inserm.fr Only protein-protein interactions imex curation human-GSCs glioblastoma multiforme cancer stem cell gscs glioblastoma (multiforme) cancer stem cell =GSCs anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jacobs KA., André-Grégoire G., Maghe C., Thys A., Li Y., Harford-Wright E., Trillet K., Douanne T., Alves Nicolau C., Frénel JS., Bidère N., Gavard J. Brain Disease - Neurological Diseases & Disorders julie.gavard@inserm.fr Accepted 2021-JUN-21 AT 19:07 BST AT 19:07 BST by KALPANAP The EMBO journal 2020 Only protein-protein interactions imex curation imex curation bcl10_human B-cell lymphoma/leukemia 10 BCL10 CIPER CLAP Cellular homolog of vCARMEN Mammalian CARD-containing adapter molecule E10 Cellular-E10 CARD-like apoptotic protein B-cell CLL/lymphoma 10 CED-3/ICH-1 prodomain homologous E10-like regulator CARD-containing molecule enhancing NF-kappa-B protein protein human Homo sapiens Human MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ DIP protein O95999 original sequence version: 69 DIP protein O95999 original sequence version: 122 DIP protein O95999 original sequence version: 60 DIP protein O95999 original sequence version: 86 F87C97F2B784BA4B malt1_human Mucosa-associated lymphoid tissue lymphoma translocation protein 1 MALT lymphoma-associated translocation Paracaspase MALT1 MLT protein protein human Homo sapiens Human MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK DIP protein Q9UDY8 original sequence version: 90 DIP protein Q9UDY8-1 original sequence version: 129 28AFB80DA025F8AB qki_human Protein quaking QKI HKQ protein protein human Homo sapiens Human MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN 43E7F3A426A494C4 qki-malt1-1 2 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association fig. 7b,c pecazine: CHEBI:135324 Z-VRPR-FMK, MALT1 inhibitor This showed that MALT1 was pulled down with QKI in GSC#1 and GSC#9, and vice versa (Fig 7B). Because MALT1 appeared excluded from nuclear fractions, the QKI/MALT1 interaction most likely occurs in the cytosol (Fig EV4C). Binding was, however, reduced in cells exposed to MPZ or Z-VRPR-FMK (Fig 7C). qki-malt1-2 2 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association fig. 7b malt1-qki-1 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association ev 4e